SecReT6
Protein ID: 229593382
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6017
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6577209..6578546 [-]
Producthypothetical protein
NoteFha
UniProt IDC3K4A5
KEGG IDpfs:PFLU6017
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.50E-16, Aligned region: 30..97
Protein Sequence: 445 a.a.     [Download]
>gi|229593382|ref|YP_002875501.1| hypothetical protein PFLU6017 [Pseudomonas fluorescens SBW25]
MSLCLTITSYHKITPGQCSEKSMNQGAMAIGRSSDNDWVLPDPERLVSSQHCVIQYKDGRYYLTDNSTNG
VELVNAGIRMRRGNSEPLQDGELIRIGDYEIQARIDFNVQAVDSQAFAGDSPNSFEALMGAVVSKPTPVP
TPAIAPQFQGASSMDTLPDLFDFLSPTAVPPPTVPDHVPSEQHDFRPPAPVVVPVAEPPAVSGSVIPEDW
DLFGDTPAPVASAAPPAPPPPPIIQPPPVVEPVLPVADSQQPDLLQAFLRGAGLDQLRLDKAQAEAQMES
IGRSYRLMVEGLIDVLRARASLKGEFRMQQTMIQPAENNPLKFAPNADEALLLLLRHGNQAFMAPDLAVR
DSFNDLRAHQLAVMAGVEAAIKHLLSRFEPAQLEERMGKPGGLSSIFNGSRQAQYWQQFTELYSNISREA
QEDFQDLFGREFSRAYEEHSARQRR
 
Nucleotide Sequence: 1338 bp     [Download]
>ref|NC_012660.1|:c6578546-6577209 hypothetical protein PFLU6017 [Pseudomonas fluorescens SBW25]
ATGTCGCTGTGTTTGACTATCACTAGTTATCACAAGATTACCCCTGGGCAGTGCTCGGAAAAGTCCATGA
ATCAGGGCGCGATGGCTATCGGCCGCAGCTCGGATAATGACTGGGTATTGCCTGATCCTGAGCGGTTGGT
GTCTTCGCAACACTGCGTTATTCAATACAAAGATGGCCGTTATTATTTAACCGATAACAGCACTAACGGT
GTGGAGTTGGTGAACGCCGGTATTCGTATGCGCCGGGGTAATAGCGAGCCACTGCAAGACGGCGAGCTGA
TCCGTATCGGCGATTACGAGATCCAGGCGCGTATCGACTTCAATGTGCAAGCCGTTGATAGCCAGGCCTT
TGCCGGCGATTCACCGAACAGCTTTGAAGCGCTGATGGGCGCCGTGGTGAGCAAGCCCACGCCAGTCCCC
ACGCCAGCGATTGCACCGCAGTTCCAGGGCGCTTCGTCGATGGACACGCTGCCGGACCTGTTTGATTTCC
TCAGCCCCACCGCCGTACCGCCACCGACCGTGCCGGACCATGTGCCTTCCGAGCAGCACGACTTTCGCCC
ACCGGCGCCGGTCGTGGTGCCCGTGGCCGAGCCGCCCGCGGTGTCGGGCTCGGTGATTCCCGAAGACTGG
GACCTGTTTGGCGATACGCCTGCGCCTGTTGCCAGCGCTGCGCCGCCGGCGCCACCTCCACCGCCGATCA
TCCAGCCGCCTCCCGTGGTCGAGCCCGTGCTCCCCGTGGCAGACAGCCAACAACCCGACCTGCTGCAAGC
CTTCCTGCGTGGCGCGGGCCTGGACCAACTGCGCCTGGACAAAGCCCAGGCCGAGGCACAGATGGAAAGC
ATCGGCCGCAGCTACCGCCTGATGGTCGAAGGCCTGATCGACGTGTTGCGTGCCCGCGCCAGCCTCAAGG
GCGAGTTCCGCATGCAGCAGACGATGATCCAGCCAGCGGAAAACAACCCGTTGAAATTCGCCCCGAACGC
CGACGAAGCGTTACTGCTCTTGCTTCGTCACGGCAACCAGGCGTTTATGGCGCCGGATCTCGCCGTGCGC
GACAGTTTCAACGACCTGCGTGCCCACCAGTTGGCGGTGATGGCCGGTGTGGAAGCGGCGATCAAGCACT
TGCTCAGTCGCTTTGAGCCGGCCCAGCTGGAGGAACGCATGGGCAAGCCCGGCGGGCTGTCGAGCATTTT
CAATGGCTCGCGCCAGGCCCAGTACTGGCAGCAGTTCACCGAGCTCTACAGCAATATTTCCCGCGAGGCC
CAGGAAGACTTCCAGGACCTGTTCGGCCGCGAATTCAGCCGAGCCTACGAAGAGCACAGCGCACGACAGC
GTCGGTAA
 Primer design