SecReT6
Protein ID: 229593383
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6018
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6578939..6579958 [+]
Producthypothetical protein
NoteTssA
UniProt IDC3K4A6
KEGG IDpfs:PFLU6018
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 53..112
Protein Sequence: 339 a.a.     [Download]
>gi|229593383|ref|YP_002875502.1| hypothetical protein PFLU6018 [Pseudomonas fluorescens SBW25]
MDVPLLLTAVSATSPCGEDMEYDAQFLQLERDAKGQPERSMGDAILPAEPPEWRSIQQQSLDLLARSKDL
RITHFLLQSALALQGVTGLAEALTLIDALLRDYWADLHPRLDADDDNDPTVRINALTGLTCDTNIRLLRE
SILTRSRTFGPVTLRAALNASGLLSFPDEQLGAQQLTAAFLDSDPEQLQATRDALIAARAACEAIEQHVN
DQVGSAQGVDLSALKQPLKQALQILNQAVPGTAGSSEPEAVSDDNAPSVDFAAAPAAPRPVGDIASRDDV
LRSLDKILAYYTRHEPSSPLPVLLNRAKNLVHADFAAIVRNLIPDGMSQFENLRGPDGE
 
Nucleotide Sequence: 1020 bp     [Download]
>ref|NC_012660.1|:6578939-6579958 hypothetical protein PFLU6018 [Pseudomonas fluorescens SBW25]
GTGGATGTGCCGTTGCTGCTCACCGCCGTTTCCGCGACTTCGCCATGTGGCGAAGACATGGAATATGACG
CGCAATTTTTGCAATTGGAGCGTGATGCCAAGGGCCAACCCGAGCGCAGCATGGGCGACGCCATCCTGCC
CGCCGAGCCGCCGGAATGGCGCAGCATCCAGCAGCAAAGCCTCGATCTGCTGGCGCGCAGCAAAGACCTG
CGCATCACCCATTTCCTGCTGCAAAGCGCCCTCGCCCTCCAAGGCGTGACCGGCCTGGCCGAAGCGCTGA
CGCTGATCGACGCCCTGCTGCGCGATTACTGGGCCGACCTGCATCCGCGCCTGGACGCCGACGACGATAA
CGACCCCACCGTACGTATCAACGCCCTCACCGGCCTGACCTGCGACACCAACATTCGCTTGCTGCGCGAA
AGCATCCTCACCCGCTCACGCACCTTCGGCCCCGTGACCCTGCGCGCGGCGCTCAACGCCAGCGGCCTGT
TGAGCTTCCCCGACGAACAACTCGGCGCCCAGCAACTCACCGCCGCGTTCCTCGACAGCGACCCCGAGCA
ACTGCAAGCCACCCGTGACGCCCTGATTGCGGCGCGTGCGGCGTGTGAAGCCATCGAACAACACGTCAAC
GACCAGGTCGGTTCCGCCCAGGGCGTGGACCTGAGTGCCTTGAAGCAACCGCTCAAGCAGGCGTTGCAGA
TACTCAATCAAGCGGTGCCAGGCACCGCCGGCAGCAGCGAACCCGAGGCCGTCAGTGACGACAATGCCCC
CTCGGTCGACTTCGCCGCCGCCCCCGCAGCACCGCGCCCCGTTGGCGATATCGCCAGCCGCGACGATGTG
CTGCGCAGCCTCGACAAGATCCTTGCGTACTACACCCGGCACGAGCCTTCGAGCCCGCTGCCGGTGCTGT
TGAACCGGGCGAAGAATCTGGTGCACGCCGACTTTGCGGCCATCGTGCGCAATCTGATTCCCGACGGCAT
GTCCCAATTTGAAAACCTGCGTGGCCCGGACGGCGAGTAA
 Primer design