SecReT6
Protein ID: 229593384
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6019
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6580013..6580519 [+]
Producthypothetical protein
NoteTssB
UniProt IDC3K4A7
KEGG IDpfs:PFLU6019
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.50E-60, Aligned region: 10..163
Protein Sequence: 168 a.a.     [Download]
>gi|229593384|ref|YP_002875503.1| hypothetical protein PFLU6019 [Pseudomonas fluorescens SBW25]
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPLAPVADRKFLEVDVDNFD
SRLKAMQPRVAFHVPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLNQLLEARTQLANLLTYMDGKTG
AEEIIMKAIKDPALLQALASAPKPAGDQ
 
Nucleotide Sequence: 507 bp     [Download]
>ref|NC_012660.1|:6580013-6580519 hypothetical protein PFLU6019 [Pseudomonas fluorescens SBW25]
GTGGCGAAGCAAAGTTCTCAGAAATTCATCGCGCGCAACCGCGCGCCTCGAGTGCAGATCGAGTACGACG
TCGAGCTCTACGGCGCCGAGAAAAAGGTCCAGCTGCCCTTCGTGATGGGTGTGATGGCCGACCTCGCCGG
CAAGCCTGCCGAGCCGTTGGCGCCGGTGGCCGACCGCAAGTTCCTTGAAGTGGACGTCGATAACTTCGAC
TCGCGCCTCAAGGCCATGCAGCCGCGCGTAGCGTTCCACGTACCGAACGAACTGACCGGCGAAGGCAACC
TGAGCCTGGACATCACCTTCGAAAGCATGGACGACTTCAGCCCGGCCGCCGTGGCCCGCAAGGTCGATTC
GCTGAACCAACTGCTCGAAGCCCGCACCCAGCTGGCCAACCTGCTGACCTACATGGACGGCAAGACGGGC
GCTGAAGAAATTATCATGAAGGCGATCAAGGACCCGGCACTGCTCCAGGCACTTGCCAGCGCGCCCAAGC
CTGCAGGGGACCAGTAA
 Primer design