SecReT6
Protein ID: 229593385
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6020
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6580522..6582021 [+]
Producthypothetical protein
NoteTssC
UniProt IDC3K4A8
KEGG IDpfs:PFLU6020
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.40E-196, Aligned region: 68..494
BMFP [PF04380], Evalue: 0.00094, Aligned region: 21..80
Protein Sequence: 499 a.a.     [Download]
>gi|229593385|ref|YP_002875504.1| hypothetical protein PFLU6020 [Pseudomonas fluorescens SBW25]
MTDNTAREGTQILGTQTEEASEFANLLLQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIES
IIAAIDAKLTAQVNQIIHHPDFQQLESAWRGLHYLVNNTESDEQLKIRVLNISKPDLHKTLKKFKGTAWD
QSPIFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHSPFIAAASPTVMGMGSWQE
LSNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTW
ANAAYAMAVNINRSFKHYGWCSRIRGIESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNG
FMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKD
EMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVIVEEVEGNPGYYNSKFYLRPHYQLEGLTVSLRLV
SKLPSAKSA
 
Nucleotide Sequence: 1500 bp     [Download]
>ref|NC_012660.1|:6580522-6582021 hypothetical protein PFLU6020 [Pseudomonas fluorescens SBW25]
ATGACTGACAATACCGCCCGCGAAGGCACCCAGATCCTGGGTACCCAGACCGAAGAAGCCAGCGAGTTCG
CGAACCTGCTGCTGCAAGAATTCAAGCCCAAGACCGAGCGTGCCCGCGAAGCCGTGGAAACCGCCGTGCG
CACCTTGGCCGAACAGGCCCTGGCGCAAACCGACCTGGTGTCCAATGACGCGATCAAGTCGATCGAATCG
ATCATTGCCGCCATCGACGCCAAGCTGACCGCCCAGGTCAACCAGATCATCCACCACCCGGATTTCCAGC
AGCTGGAAAGCGCCTGGCGTGGCCTGCACTACTTGGTCAACAACACCGAAAGCGATGAGCAGCTGAAGAT
CCGCGTGCTCAACATCTCCAAGCCGGACCTGCACAAGACCCTGAAGAAATTCAAGGGCACCGCGTGGGAC
CAGAGCCCGATCTTCAAGAAGATGTACGAAGAAGAATACGGCCAGTTCGGCGGCGAGCCGTACGGCTGCC
TGGTGGGCGACTACTACTTCGACCAGTCGCCACCCGACGTGGAGCTGCTGGGCGAGCTGTCGAAAGTCTG
CGCCGCCATGCACTCCCCGTTCATCGCTGCGGCATCGCCGACCGTGATGGGCATGGGCTCGTGGCAGGAG
CTGTCGAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCAGGCTGGCGCTCGCTGCGTG
AATCGGAAGACTCGCGCTACATCGGCCTGACCATGCCGCGCTTCCTCGCGCGCCTGCCGTACGGCGCCAA
GACTGACCCGGTGGAAGCCTTCGCCTTCGAAGAAAACACCGACGGTGCCGACAGCTCCAAGTACACCTGG
GCCAACGCCGCGTACGCGATGGCTGTGAACATCAACCGTTCGTTCAAGCACTACGGCTGGTGCTCGCGCA
TCCGTGGTATCGAGTCCGGCGGCGAAGTGGAAAACCTGCCGGCGCACACGTTCCCTACCGATGACGGTGG
CGTGGACATGAAGTGCCCGACCGAAATCGCCATCAGCGACCGCCGTGAAGCGGAACTGGCGAAGAACGGT
TTCATGCCTCTGCTGCACAAGAAAAACACCGACTTCGCCGCGTTCATTGGCGCGCAGTCGCTGCAGAAAC
CGGCCGAATACGATGACCCGGACGCCACCGCCAACGCCAACCTGGCCGCGCGCCTGCCGTACCTGTTCGC
CACCTGCCGTTTCGCCCACTACTTGAAGTGCATCGTGCGCGACAAGATCGGCTCCTTCAAAGAGAAGGAC
GAGATGCAGCGCTGGTTGCAGGACTGGATCCTCAACTACGTGGACGGTGACCCGGCGCACTCCACCGAAA
CCACCAAGGCCCAGCACCCATTGGCGGCTGCCGAAGTGATCGTGGAAGAAGTCGAAGGCAACCCGGGGTA
CTACAACTCCAAGTTCTACCTGCGCCCGCACTACCAGCTCGAAGGGCTGACCGTGTCGCTGCGCCTGGTA
TCGAAACTGCCTTCGGCGAAAAGCGCGTAA
 Primer design