SecReT6
Protein ID: 229593387
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6022
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6582708..6583223 [+]
Producthypothetical protein
NoteTssE
UniProt IDC3K4B0
KEGG IDpfs:PFLU6022
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-23, Aligned region: 37..146
Protein Sequence: 171 a.a.     [Download]
>gi|229593387|ref|YP_002875506.1| hypothetical protein PFLU6022 [Pseudomonas fluorescens SBW25]
MVTEIASRDRLQPSLLDRLTDDDPTNPKESADKRVLSLTQLKASVLRDLAWLLNTTSLLDADATLHTPAG
TSVVNYGLPALAGNSVSSVDIKALEALIYQAIATFEPRILRHTLRVKARVGHGEMNHNALSFEIEGDLWA
QPVPLRLLLQTDLDLESGHVRVVNADQRRRP
 
Nucleotide Sequence: 516 bp     [Download]
>ref|NC_012660.1|:6582708-6583223 hypothetical protein PFLU6022 [Pseudomonas fluorescens SBW25]
GTGGTAACTGAAATCGCTTCCCGCGACCGTCTGCAACCGTCCCTGCTGGACCGGCTGACCGACGACGACC
CAACCAATCCCAAGGAAAGCGCCGACAAACGCGTGCTGTCCCTGACCCAATTGAAAGCCTCGGTGCTGCG
TGACCTGGCGTGGCTGCTCAACACCACGTCGTTGCTCGATGCCGATGCCACGCTGCACACCCCGGCCGGT
ACGTCGGTGGTCAATTACGGCCTGCCGGCGCTGGCGGGCAACAGTGTTTCCAGTGTCGACATCAAGGCCC
TGGAAGCGCTGATCTACCAGGCCATCGCCACCTTTGAACCGCGCATCCTGCGCCATACCCTGCGGGTCAA
AGCCCGTGTCGGCCATGGCGAGATGAATCACAACGCCCTGAGCTTCGAGATCGAAGGCGACCTGTGGGCG
CAGCCGGTGCCGTTGCGCCTATTGCTGCAAACCGACCTCGACCTGGAATCCGGCCATGTGCGTGTGGTGA
ATGCCGACCAGCGGAGGCGCCCATGA
 Primer design