SecReT6
Protein ID: 229593388
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6023
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6583220..6585079 [+]
Producthypothetical protein
NoteTssF
UniProt IDC3K4B1
KEGG IDpfs:PFLU6023
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-218, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|229593388|ref|YP_002875507.1| hypothetical protein PFLU6023 [Pseudomonas fluorescens SBW25]
MNPRLLELYNQELHHVRESAAEFAKEYPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLQTDPDEGSLASGFPLPRDTVLRAALGRETQTCCEYRTAHPVTLWP
LQVSSAEYFGNPAAVLGRLAASEPKAKAGLRLTLRTGAELPFNSLDLDNLPLYLSGADEQPFRLYEQLLG
NACAVFARKPGGDWVERLPQDALRSRGFDDADAAMPVVARAFQGYRLLQEYFALPHRYLFVEFAELSRAV
KRCDGQELELIVLFDRHEPSLEGSVGAAQFLPFCTPAINLFPKRVDRIHLSDRVSEHHVIADRTRPMDFE
IHSLSGITGHGTGPEQPFLPFYAVRDPSRYGRDQAYYTVRREPRVLSSDQRRNGPRSTYVGSETFVNLVD
SGQAPYRHDLRQLGVTALCTNRDLPLFMSVGNGKTDFTLADSAPVLAVRCVAGPSRPRPSHAHDAKAWRL
ISQLSLNYLSLSEQGQGAGALRELLRLYGDSNDAALQLQIEGLREVSSKAVTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVLERFLARYVSINSFTETVIRTTERGEIMRWKAKPGRRPTL
 
Nucleotide Sequence: 1860 bp     [Download]
>ref|NC_012660.1|:6583220-6585079 hypothetical protein PFLU6023 [Pseudomonas fluorescens SBW25]
ATGAACCCGCGCCTGCTGGAGCTGTACAACCAGGAACTGCACCACGTGCGCGAAAGCGCCGCCGAGTTCG
CCAAGGAATACCCGAAGATCGCCAGTCGGCTGACCCTGTCCGGTATGGACTGCGCCGACCCGTACGTCGA
ACGCCTGCTTGAAGGGTTTGCCTACCTCACGGCCCGCGTGCAGCTCAAGCTCGATGCCGAGTACCCGACC
TTCACCCATAACCTGCTGGAAATCGCCTACCCGCACTACCTGGCGCCGACGCCGTCGATGACCGTGGTGC
AATTGCAGACCGACCCGGATGAAGGCTCCCTGGCCAGCGGTTTCCCGCTGCCCCGCGACACGGTATTGCG
TGCCGCCCTCGGTCGTGAAACCCAGACCTGCTGCGAGTACCGCACCGCGCACCCGGTGACGTTGTGGCCG
TTGCAGGTCAGCAGCGCCGAGTATTTCGGCAACCCCGCCGCCGTGCTGGGCCGCCTGGCCGCCAGTGAAC
CGAAAGCCAAGGCCGGCCTGCGCCTGACCCTGCGCACCGGCGCCGAATTGCCTTTCAACAGCCTCGACCT
GGATAACCTGCCGCTGTACCTCAGCGGTGCCGACGAGCAACCGTTCCGCCTTTACGAGCAGTTGTTGGGC
AACGCCTGCGCGGTGTTTGCACGCAAGCCCGGCGGTGACTGGGTAGAACGCCTGCCGCAGGACGCATTGC
GCTCCCGTGGTTTTGACGATGCCGACGCCGCCATGCCGGTTGTCGCGCGGGCCTTCCAGGGCTATCGCCT
GTTGCAGGAATACTTCGCCCTGCCCCACCGCTACCTGTTCGTCGAGTTCGCCGAGCTGAGCCGTGCGGTC
AAGCGTTGCGACGGTCAGGAGTTGGAACTGATCGTGTTGTTCGACCGCCACGAACCGAGCTTGGAAGGCA
GCGTCGGCGCCGCGCAGTTCCTGCCGTTCTGCACGCCGGCGATCAACCTGTTTCCCAAGCGCGTAGACCG
TATTCACCTGTCCGACCGGGTCAGCGAGCACCATGTGATCGCCGACCGCACGCGGCCGATGGATTTCGAG
ATTCATTCGTTGAGCGGCATCACGGGCCATGGCACCGGGCCGGAACAACCCTTTTTACCGTTTTATGCGG
TGCGCGACCCGTCGCGCTATGGCCGCGACCAGGCCTATTACACCGTGCGCCGTGAACCACGCGTGCTGTC
CAGCGACCAGCGCCGCAACGGCCCGCGCTCCACGTACGTGGGCAGTGAAACCTTTGTCAACCTGGTGGAC
AGCGGGCAAGCGCCCTACCGCCACGACCTGCGCCAGCTCGGCGTGACCGCGCTGTGCACCAACCGCGACC
TGCCCTTGTTCATGAGCGTGGGCAACGGCAAGACCGACTTCACCCTGGCCGACAGCGCGCCGGTATTGGC
CGTGCGCTGCGTCGCCGGCCCGAGTCGCCCGCGCCCCAGCCATGCCCATGACGCCAAGGCGTGGCGCTTG
ATCAGCCAACTGTCGCTCAACTACCTGTCGTTGAGCGAACAGGGCCAGGGCGCCGGCGCCTTGCGTGAAT
TGCTGCGCCTGTACGGCGACAGCAACGACGCGGCGCTGCAATTGCAGATCGAAGGCTTGCGCGAGGTCAG
CAGCAAAGCGGTGACCCGCCGCCTGCCGATGCCCGGCCCGATCGTGTTTGGGCGCGGCCTGGAGATCACA
CTGGAATTCGATGAAAACGCGTTTCGCGGCACCGGCGTATTCCTGCTCGGTGCGGTGCTGGAACGCTTCC
TGGCACGCTACGTGTCGATCAACAGTTTTACCGAGACGGTGATCCGTACCACCGAACGCGGCGAGATCAT
GCGATGGAAAGCCAAGCCCGGACGTCGTCCGACCCTGTGA
 Primer design