SecReT6
Protein ID: 229593389
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6024
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6585043..6586086 [+]
Producthypothetical protein
NoteTssG
UniProt IDC3K4B2
KEGG IDpfs:PFLU6024
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.70E-110, Aligned region: 20..320
Protein Sequence: 347 a.a.     [Download]
>gi|229593389|ref|YP_002875508.1| hypothetical protein PFLU6024 [Pseudomonas fluorescens SBW25]
MESQARTSSDPVSTLDAMHQAPWEYDFFQALRRIECESPELPRLGHSLRLADDPLRLGQQADCTFAPATL
ASVDPGGDGKPARLEQFFFGLGGPNGPLPLHITEYVRERQRNNADSTSKHFLDVFHHRLLSLFYRAWAEA
RPTVSHDRPDDDYWSARLAALSGRGMPSLLNQGLIPDAAKLHYSGHLSAQTRYPDGLKAILGEYFGLPVA
IEEYVGQWLGLPERSRVGVSANRLGVDFCLGSFVWDRQHKFRIRLGPLTLDDYMGMLPGHQPFNELVAWV
AEYLGHELDWDLNLVLQQAEVPALQLNGQFRLGFNTWLGKPEHDANDLILARHYADHATTSRNPEHG
 
Nucleotide Sequence: 1044 bp     [Download]
>ref|NC_012660.1|:6585043-6586086 hypothetical protein PFLU6024 [Pseudomonas fluorescens SBW25]
ATGGAAAGCCAAGCCCGGACGTCGTCCGACCCTGTGAGTACCCTGGATGCGATGCATCAGGCACCCTGGG
AATACGATTTCTTCCAGGCGTTGCGGCGTATCGAGTGCGAATCGCCGGAACTGCCGCGCCTGGGCCATTC
CCTGCGCCTGGCGGATGACCCGCTGCGCCTGGGTCAGCAGGCGGATTGCACCTTTGCCCCGGCCACGTTG
GCGTCGGTCGACCCCGGTGGCGACGGCAAGCCGGCGCGGCTGGAGCAGTTCTTCTTCGGCCTTGGCGGCC
CCAACGGCCCGCTGCCGCTGCATATCACCGAATATGTACGCGAGCGCCAGCGCAACAATGCCGACAGCAC
CAGCAAACACTTCCTGGATGTGTTCCACCATCGCCTACTGAGCCTGTTTTACCGAGCCTGGGCCGAGGCG
CGGCCGACGGTCAGCCATGACCGCCCGGACGATGACTATTGGTCTGCGCGCCTCGCCGCACTGAGTGGTC
GCGGCATGCCGAGCCTGCTGAATCAGGGGCTCATCCCGGATGCCGCGAAGCTGCATTACAGCGGCCACCT
CTCGGCGCAAACCCGCTACCCGGACGGCTTGAAAGCCATTCTCGGCGAGTACTTCGGCCTGCCGGTGGCG
ATCGAAGAGTACGTCGGCCAATGGCTCGGGCTGCCCGAACGCAGCCGCGTGGGCGTGAGCGCCAACCGCC
TCGGCGTGGACTTTTGCCTGGGCAGCTTCGTGTGGGATCGCCAGCACAAATTCCGTATCCGCCTGGGCCC
CCTCACGCTGGATGACTACATGGGCATGCTGCCCGGCCACCAACCGTTCAACGAGCTGGTGGCGTGGGTG
GCCGAGTACCTGGGCCATGAACTGGACTGGGACTTGAACCTGGTTCTGCAACAAGCCGAAGTGCCAGCGC
TGCAACTCAACGGCCAGTTCCGCCTGGGCTTCAACACCTGGCTCGGTAAACCCGAGCATGACGCCAACGA
CCTAATCCTGGCCCGGCACTACGCCGACCACGCCACCACCTCAAGGAATCCAGAGCATGGGTGA
 Primer design