SecReT6
Protein ID: 229593390
SecReT6 ID482
T6SS typei3
Gene symbolclpB2
Locus tagPFLU6025
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6586079..6588742 [+]
Productchaperone
NoteTssH
UniProt IDC3K4B3
KEGG IDpfs:PFLU6025
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-39, Aligned region: 616..782
AAA [PF00004], Evalue: 1.30E-18, Aligned region: 234..368
AAA [PF00004], Evalue: 1.30E-18, Aligned region: 622..706
ClpB_D2-small [PF10431], Evalue: 2.90E-15, Aligned region: 526..539
ClpB_D2-small [PF10431], Evalue: 2.90E-15, Aligned region: 789..863
AAA_5 [PF07728], Evalue: 2.60E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 2.60E-12, Aligned region: 351..364
AAA_5 [PF07728], Evalue: 2.60E-12, Aligned region: 621..735
AAA_16 [PF13191], Evalue: 6.40E-12, Aligned region: 43..78
AAA_16 [PF13191], Evalue: 6.40E-12, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 6.40E-12, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 6.40E-12, Aligned region: 501..548
AAA_16 [PF13191], Evalue: 6.40E-12, Aligned region: 591..666
Sigma54_activat [PF00158], Evalue: 8.40E-07, Aligned region: 213..247
Sigma54_activat [PF00158], Evalue: 8.40E-07, Aligned region: 620..739
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 358..399
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 619..642
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 683..703
AAA_25 [PF13481], Evalue: 7.70E-06, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 7.70E-06, Aligned region: 619..646
Zeta_toxin [PF06414], Evalue: 4.20E-05, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 4.20E-05, Aligned region: 615..661
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 285..318
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 621..642
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 688..703
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 17..46
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 234..255
AAA_19 [PF13245], Evalue: 0.00032, Aligned region: 619..643
NACHT [PF05729], Evalue: 0.00033, Aligned region: 234..334
NACHT [PF05729], Evalue: 0.00033, Aligned region: 622..648
IstB_IS21 [PF01695], Evalue: 0.0004, Aligned region: 217..255
IstB_IS21 [PF01695], Evalue: 0.0004, Aligned region: 621..649
Clp_N [PF02861], Evalue: 0.00056, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.00056, Aligned region: 108..149
AAA_18 [PF13238], Evalue: 0.00059, Aligned region: 234..251
AAA_18 [PF13238], Evalue: 0.00059, Aligned region: 623..649
AAA_18 [PF13238], Evalue: 0.00059, Aligned region: 812..851
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 234..251
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 621..657
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 619..646
Torsin [PF06309], Evalue: 0.0022, Aligned region: 579..645
Protein Sequence: 887 a.a.     [Download]
>gi|229593390|ref|YP_002875509.1| chaperone [Pseudomonas fluorescens SBW25]
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLQDSDLHRIIRQFNVEPARLARD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVLGILKTPSLRHALLGLSSEFDK
IKAEALSERFDEYVGDSPENALSASDGFNAGAVPGEASGAMAPSAMGKQEALKRFTVDLTEQARSGKLDP
IVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRSLDVGLLQAGA
SMKGEFEQRLRQVIEDVQASPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVAEPSEDKALLMMRGVASTMEKHHQVQILDEALEASVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREHAIGIAIGARQTNSEALLSAERERLAT
LESRWAEEKALVDELLATRATLREKAGAVDSGDDALREQLVDLQQRLSALQGETPLILPTVDYQAVASVV
ADWTGIPVGRMARNELETVLNLDQHLKKRIIGQDHALQMIAKRIQTSRAGLDNPSKPIGVFMLAGTSGVG
KTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVE
KAHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTTNAGTELISQVCKDPANIPEPEEIAKALRQPLL
EIFPPALLGRLVTIPYYPLSDEMLKAITRLQLGRIKKRVETTHKVAFDYDDAVVDLIVSRCTETESGGRM
IDTILTNSLLPDMSREFLTRMLEGKAMAGVRISSRDNELHYDFSDAD
 
Nucleotide Sequence: 2664 bp     [Download]
>ref|NC_012660.1|:6586079-6588742 chaperone [Pseudomonas fluorescens SBW25]
ATGGGTGAAATCAGTCGCGCCGCACTGTTCGGCAAACTCAACAGCGTGGCCTACAAGGCCATCGAAGCCG
CCACGGTGTTCTGCAAACTGCGGGGCAACCCGTATGTGGAGCTTGCCCACTGGTTTCACCAGTTGCTGCA
ACTGCAGGACTCGGACCTGCACCGCATCATCCGCCAGTTCAACGTCGAGCCGGCGCGCCTGGCCCGCGAC
CTGACTGAAGCCCTGGACCGCCTGCCACGCGGCTCGACCTCGATCACCGACCTGTCCTCCCATGTGGAAG
AAGCGGTGGAGCGCGGCTGGGTCTACGGCAGCCTGATGTTCGGCGAAAGCCAAGTACGCACCGGTTATCT
GGTGCTCGGCATTCTCAAGACCCCGAGCCTGCGCCATGCGCTGCTGGGCTTGTCTTCCGAGTTCGACAAG
ATCAAGGCCGAGGCCCTGAGCGAGCGCTTTGATGAATACGTGGGCGACTCGCCGGAAAACGCGCTGAGCG
CCAGCGACGGTTTCAACGCCGGCGCCGTGCCGGGCGAAGCCAGCGGTGCCATGGCGCCCAGTGCGATGGG
CAAACAGGAAGCGCTCAAGCGCTTCACCGTTGACCTGACCGAACAGGCCCGCAGCGGCAAGCTCGACCCG
ATCGTGGGTCGTGATGAGGAGATCCGCCAACTGGTCGACATCCTCATGCGCCGCCGCCAGAACAACCCGA
TCCTCACCGGTGAAGCCGGGGTGGGCAAGACCGCCGTGGTCGAAGGTTTCGCCCTGCGTATCGTCGCCGG
TGACGTGCCACCCGCGCTCAAAGATGTGGAACTGCGCAGCCTCGACGTGGGCCTGCTGCAAGCCGGCGCC
AGCATGAAAGGCGAATTCGAACAGCGCCTGCGCCAGGTCATTGAAGACGTCCAGGCCTCACCCAAGCCGA
TCATCCTGTTTATCGACGAAGCCCACACCCTGGTGGGTGCCGGTGGCGCCGCCGGCACCGGTGACGCAGC
CAACCTGCTCAAGCCTGCATTGGCGCGTGGCACCCTGCGTACTGTGGCCGCCACCACCTGGGCCGAGTAC
AAGAAGCACATCGAGAAAGACCCGGCCCTGACGCGCCGTTTCCAGGTGGTGCAAGTCGCCGAACCGTCGG
AAGACAAAGCGCTGCTGATGATGCGTGGCGTGGCGTCGACCATGGAAAAACACCACCAGGTGCAGATCCT
CGACGAAGCCCTGGAAGCCTCGGTGAAGCTGTCCCACCGCTACATCCCGGCGCGCCAGTTGCCGGACAAA
TCCGTAAGCCTGCTGGACACCGCTTGCGCCCGCGTCGCCATCAGCCTGCACGCGGTGCCGGCCGAAGTGG
ACGACAGCCGCCGCCGCATCGAAGCCCTGGAAACCGAGCTGCAGATCATCGCTCGCGAGCATGCCATTGG
TATCGCGATTGGCGCGCGTCAAACCAATAGCGAAGCACTGTTGAGCGCTGAACGTGAGCGCCTGGCGACG
CTGGAAAGCCGCTGGGCCGAAGAGAAAGCGCTGGTGGACGAACTGCTCGCTACCCGCGCGACCTTGCGCG
AAAAAGCCGGCGCCGTAGACAGTGGCGACGACGCTTTGCGCGAGCAACTGGTCGACCTGCAACAACGCCT
CAGCGCGCTGCAAGGTGAAACCCCGCTGATCCTGCCGACGGTGGACTACCAGGCCGTGGCCTCGGTGGTC
GCCGACTGGACCGGCATCCCGGTGGGCCGCATGGCGCGCAATGAGCTGGAGACGGTGCTCAACCTCGACC
AGCACCTGAAGAAACGCATCATCGGCCAGGACCACGCCCTGCAGATGATCGCCAAGCGCATCCAGACGTC
CCGCGCCGGTCTCGACAACCCGAGCAAGCCGATTGGCGTGTTCATGCTGGCCGGCACCTCGGGCGTGGGC
AAGACCGAAACCGCCCTGGCCCTGGCCGAAGCCATGTACGGCGGCGAGCAGAACGTCATCACCATCAACA
TGAGCGAATTCCAGGAAGCCCACACGGTGTCGACCCTCAAGGGCGCGCCTCCGGGCTATATCGGCTACGG
CGAAGGCGGCGTGCTGACCGAAGCCGTGCGGCGCAAACCCTACAGCGTGGTACTGCTGGACGAGGTGGAG
AAAGCCCACCCGGACGTGCATGAAATCTTCTTCCAGGTGTTCGACAAGGGCGTGATGGAAGACGGCGAAG
GCCGGGTGATCGACTTCAAGAACACCCTGATCCTGCTGACCACCAACGCCGGTACCGAGCTGATTTCCCA
GGTGTGCAAAGACCCGGCGAACATCCCTGAGCCGGAAGAAATCGCCAAGGCCCTGCGCCAGCCGCTGCTG
GAGATCTTTCCGCCGGCACTGCTCGGCCGCCTAGTGACCATTCCGTACTACCCGCTGAGCGATGAGATGC
TCAAGGCGATCACCCGCCTGCAACTGGGTCGCATCAAGAAGCGCGTGGAGACGACCCACAAGGTTGCCTT
CGACTACGACGACGCGGTGGTCGACCTGATCGTCTCGCGTTGCACCGAAACCGAAAGCGGCGGGCGCATG
ATCGACACCATTCTTACCAACAGCCTGCTGCCGGACATGAGCCGTGAGTTCCTCACGCGCATGCTCGAAG
GCAAGGCGATGGCGGGTGTACGCATCAGCAGCCGGGATAATGAATTGCACTACGACTTCAGCGACGCAGA
TTGA
 Primer design