SecReT6
Protein ID: 229593393
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6028
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6591302..6595732 [+]
Producthypothetical protein
NotePAAR
UniProt IDC3K4B6
KEGG IDpfs:PFLU6028
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 447..471
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 497..533
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 560..577
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 586..621
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 607..643
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 657..686
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 671..707
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 713..734
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 737..770
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 755..792
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 777..809
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 799..833
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 839..871
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 888..922
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 926..943
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 952..977
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 1009..1023
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 1043..1076
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 1067..1100
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 1114..1125
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 1117..1152
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 1138..1170
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 1159..1190
RHS_repeat [PF05593], Evalue: 7.40E-57, Aligned region: 1237..1256
RHS [PF03527], Evalue: 3.80E-19, Aligned region: 655..682
RHS [PF03527], Evalue: 3.80E-19, Aligned region: 690..707
RHS [PF03527], Evalue: 3.80E-19, Aligned region: 818..830
RHS [PF03527], Evalue: 3.80E-19, Aligned region: 1224..1262
PAAR_motif [PF05488], Evalue: 9.10E-12, Aligned region: 80..121
PAAR_motif [PF05488], Evalue: 9.10E-12, Aligned region: 98..225
RES [PF08808], Evalue: 2.20E-10, Aligned region: 543..543
RES [PF08808], Evalue: 2.20E-10, Aligned region: 1009..1051
RES [PF08808], Evalue: 2.20E-10, Aligned region: 1364..1473
DUF2283 [PF10049], Evalue: 0.002, Aligned region: 440..455
DUF2283 [PF10049], Evalue: 0.002, Aligned region: 493..514
DUF2283 [PF10049], Evalue: 0.002, Aligned region: 745..762
DUF2283 [PF10049], Evalue: 0.002, Aligned region: 857..918
Protein Sequence: 1476 a.a.     [Download]
>gi|229593393|ref|YP_002875512.1| hypothetical protein PFLU6028 [Pseudomonas fluorescens SBW25]
MSDALLWAARLGDGLSHTSVMADILGGVLEVAANVAITALATAAVVAATGITVATGGLGACVLGAVVGVI
VGIAMSKTGADKGLSAMCEGIGNALFPPSVMATILSGSTDTLINALPAARAAGVVPSHVAPAGTETETTP
PAPEHSEEPGYLDMAKGFFTQMWRPTVATPAPGAVPKPLDVVTCTKHPPMPPQFLAEGSEKVTVNGQPAV
RSGDRSTCDATVVSSGLISPNVTIGGGSVVVREIRSGKTPGVGLAVTALMMLKGGKGKFLSNLPCMLLAG
VNSFVVSQAMGALANAAMGSSNPVHASTGAKVLGGPEELDFALPGIMPIDWQRFYNSRDERRDGLFGAGW
SVPYEVSVQLLPHPEGGDYALYTDEQGRRIDMGSIPLGGAVFSAGEGLSVKRHLSGQWLIESADGLYRLF
DPAPQDASLLRLSQLGDRNDNRIHLDYDDDGRLLGLRDTFGLVRVELTYDNTWPHRISRIERLYPDQHRE
VLMHYAYDARGDLASVRQSDGHVKRRFAYDAGQRMVEHQLPTGLRCFYQWAKVDDLEWRVVRHWTEAGDT
YTFDYALDTGITRITDGLARVSIRHWDERHQIIASTDALGRTWAFRWNDDSQLLGATDPLGGHYQFSYDD
AGNLTETLDPLGRSESTLWLEHWALPLAETDAAGNTWQYDYDSRGNCIRETDPLGNRTVYHYDGHGQVRE
IIDASGKRKTLRWSPLGQLSEHTDCTGLITRLSYCKRGLLLVSTDALGERTTFKYDDQGRLISKQLPDGR
SEHYQRDASGQLIGYSDPAGHTTRFEHSSNGQLRQRIDAHGRRVELSHDVYGRLHSLTNENGEHYRFDWD
DGDRLTLEQRLDGCRKRYTYDPLDNVTQVETLASSDAEPAIIHDLERDAAGRLIAKRTVDGCTTYRYDEL
DQVTAITFTGHDGEQQTLGFGYDALGQLTLEQSAAGCLEHLYDELGNLTQTRLPDGRWLNRLRYGSGHLH
QVNLDGQVISDFERDRLHREVLRTQGRISTRSEYDRSGRLRARQRRQPDHSLLHPPAQTRLGYDDSDQLV
ERYDSQPGAAHRQLLHYDATGRILASQDNLLGQREVFRYDPAANLLDGSGQVANNRLLTYQDKHYRYDGF
GRMVEKRSLRRGTQRFSYDAEQRLAQVHNDDGSWVIMTYDPLGRRTAKTTYDRNGVQRSQTRFTWDALQL
VQEHCNQQTSLYIYADEGYEPLARIDGTGDLQKIRYYHNDLNGLPERLTESDGHTVWQARYEVWGNTVEE
SREPYFIEEQNLRFQGQYLDRETGLHYNTLRFYDPDIGRFTTPDPIGLAGGLNLYQYAPNPLSWIDPLGL
MKCSSPPKGRKVSRTVYRFEEPGRIGTTWQAHKWNVESTHRYTTKGVGGVYGANSRKTALGEVTHWKVDL
SKRVLVSKKVQLNNVLDLTRADVRKQLGVSLKSITGSKYTETHQIGNWAKANGYDGILAPSARNPTGSNL
ISFAGF
 
Nucleotide Sequence: 4431 bp     [Download]
>ref|NC_012660.1|:6591302-6595732 hypothetical protein PFLU6028 [Pseudomonas fluorescens SBW25]
ATGTCTGACGCACTGCTCTGGGCCGCGCGCCTGGGCGATGGGCTGTCCCACACCTCTGTCATGGCGGACA
TCCTCGGCGGCGTGCTGGAAGTGGCGGCTAACGTGGCGATTACCGCGCTGGCAACCGCCGCGGTGGTGGC
GGCTACCGGCATTACCGTCGCGACTGGTGGACTGGGGGCCTGCGTGCTGGGGGCGGTAGTCGGCGTTATC
GTCGGCATCGCCATGAGCAAGACCGGGGCCGACAAGGGGTTGAGCGCCATGTGCGAGGGAATCGGCAACG
CGCTGTTCCCTCCCTCGGTCATGGCCACAATCCTCAGCGGGTCCACCGACACACTGATCAACGCCTTGCC
CGCTGCGCGCGCGGCCGGCGTCGTGCCCTCCCACGTTGCACCTGCGGGCACCGAAACCGAAACAACGCCG
CCAGCACCGGAACACAGCGAAGAGCCCGGCTACCTGGACATGGCCAAAGGGTTCTTTACGCAAATGTGGC
GCCCCACCGTCGCCACGCCAGCGCCCGGTGCAGTCCCTAAACCGCTGGACGTGGTGACCTGCACAAAACA
CCCGCCGATGCCGCCGCAGTTTCTGGCCGAAGGCTCGGAAAAGGTCACGGTCAACGGTCAACCGGCGGTA
CGCAGCGGTGACCGGAGCACCTGCGACGCCACCGTGGTGTCGTCGGGGCTGATTTCGCCCAATGTGACGA
TCGGCGGGGGCTCAGTGGTGGTGCGCGAGATCCGCAGCGGCAAGACGCCGGGCGTTGGCCTGGCCGTCAC
CGCGCTGATGATGCTCAAGGGGGGTAAAGGCAAGTTCCTCAGCAACCTTCCCTGCATGCTGCTGGCAGGC
GTCAATTCGTTTGTGGTCAGTCAGGCCATGGGCGCGCTGGCCAACGCCGCCATGGGCTCTTCCAACCCGG
TGCACGCGAGCACGGGGGCCAAAGTGCTGGGCGGCCCCGAGGAGCTGGATTTCGCCTTGCCCGGGATCAT
GCCCATCGACTGGCAGCGCTTCTACAACAGCCGGGACGAACGCCGCGATGGCTTGTTTGGTGCCGGCTGG
AGTGTGCCCTATGAAGTCAGCGTGCAGCTGCTGCCTCACCCTGAAGGGGGCGACTACGCGTTGTACACCG
ACGAGCAGGGTCGACGTATCGACATGGGTTCGATCCCTTTGGGGGGTGCCGTGTTCAGCGCTGGCGAAGG
CCTCAGCGTCAAGCGTCATTTGAGTGGCCAGTGGCTGATCGAAAGCGCAGACGGCTTGTACCGGCTATTC
GATCCGGCGCCACAGGACGCATCGTTGCTACGCCTGAGCCAACTGGGAGATCGCAACGACAACCGAATCC
ACCTCGACTATGACGACGATGGTCGCCTGCTGGGCCTGCGTGACACCTTTGGCCTGGTCAGGGTCGAGCT
GACGTACGACAACACTTGGCCCCATCGCATCAGCCGAATCGAACGCCTGTACCCCGACCAACACCGTGAA
GTCCTGATGCATTACGCCTACGACGCCCGTGGCGACCTGGCCTCTGTACGCCAGTCCGACGGGCACGTGA
AGCGCCGTTTTGCCTATGATGCCGGGCAGCGCATGGTCGAGCATCAATTGCCCACCGGCCTGCGTTGCTT
CTATCAGTGGGCCAAGGTTGACGACCTTGAATGGCGTGTTGTCCGGCATTGGACGGAGGCCGGGGACACC
TACACATTCGACTATGCGTTGGATACAGGCATCACCCGTATCACCGACGGGCTGGCGCGCGTCAGCATTC
GACACTGGGATGAGCGACACCAGATCATCGCGTCCACCGATGCACTGGGGCGAACCTGGGCCTTCCGGTG
GAATGATGATAGCCAACTGCTGGGCGCAACCGACCCTCTCGGTGGGCATTATCAGTTCAGCTACGACGAT
GCCGGCAACCTGACTGAGACCCTCGACCCCCTGGGGCGCAGTGAATCGACCTTGTGGCTGGAGCACTGGG
CGCTGCCACTGGCGGAGACCGATGCCGCTGGCAATACCTGGCAGTACGATTACGACTCGCGGGGCAACTG
CATTCGCGAAACCGACCCACTGGGCAACCGCACGGTCTATCACTATGACGGACACGGCCAAGTCAGGGAG
ATCATCGACGCCAGCGGCAAGCGCAAGACCTTGCGCTGGTCCCCACTGGGTCAATTGAGCGAGCACACCG
ACTGTACGGGCCTTATCACCCGTTTGAGCTACTGCAAGCGAGGCTTGCTGCTGGTCAGTACCGACGCGCT
CGGGGAACGCACCACCTTCAAGTATGACGACCAGGGCCGACTGATCAGCAAGCAGTTGCCCGATGGGCGC
AGCGAGCACTATCAGCGTGACGCCAGCGGCCAGTTGATCGGCTACAGCGACCCTGCCGGCCACACCACGC
GCTTCGAGCATTCGTCGAACGGCCAGTTGCGCCAGCGCATCGACGCCCATGGCCGCCGTGTGGAGCTGAG
CCATGACGTCTATGGCCGCCTGCACAGCCTGACCAACGAAAATGGTGAGCACTACCGATTCGACTGGGAC
GACGGTGATCGCCTGACCCTCGAACAGCGCCTGGACGGCTGTCGAAAACGGTACACGTACGACCCGCTGG
ACAATGTCACACAGGTAGAAACCCTCGCATCGTCCGACGCCGAGCCCGCCATCATTCATGATCTGGAGCG
GGATGCAGCAGGCCGGCTGATCGCCAAGCGCACCGTAGATGGTTGCACGACGTACCGCTACGATGAACTC
GACCAAGTCACAGCCATCACCTTTACAGGGCACGATGGCGAGCAGCAAACCCTGGGCTTCGGTTATGACG
CCCTCGGTCAGCTGACCCTCGAACAAAGCGCCGCCGGTTGCCTGGAGCATCTCTACGACGAATTGGGCAA
CCTGACCCAGACCCGACTTCCCGACGGCCGCTGGCTCAACCGCCTGCGCTACGGTAGCGGGCACTTGCAT
CAGGTCAACCTGGATGGGCAGGTCATCAGTGACTTCGAGCGGGACCGTCTGCACCGCGAAGTGCTGCGCA
CCCAGGGCCGTATCAGTACGCGTAGCGAATATGACCGCAGTGGACGTCTGCGTGCCCGCCAGCGCCGCCA
ACCGGACCACTCGCTGTTACATCCGCCGGCGCAGACACGCTTGGGCTATGACGACAGCGACCAACTGGTC
GAACGCTACGACAGCCAGCCCGGCGCGGCACACCGCCAACTGCTGCATTACGACGCTACCGGCCGCATTC
TGGCTAGCCAGGACAACCTCCTGGGCCAACGGGAAGTCTTCCGCTACGACCCGGCGGCTAACCTGCTGGA
CGGCTCAGGACAGGTCGCCAACAACCGATTGCTGACCTACCAGGACAAACATTACCGCTATGACGGTTTT
GGCCGGATGGTTGAAAAGCGCAGCCTTCGGCGCGGCACCCAACGCTTCAGCTACGACGCGGAGCAACGGC
TGGCACAGGTGCACAACGATGACGGTTCCTGGGTCATCATGACCTATGACCCGCTGGGCCGGCGCACCGC
CAAGACCACCTACGACCGCAACGGTGTGCAGCGGAGCCAGACACGTTTCACTTGGGACGCGCTGCAACTC
GTGCAGGAGCACTGCAATCAGCAGACCAGCCTCTATATCTATGCCGACGAGGGCTACGAACCACTGGCCC
GTATCGATGGCACAGGTGACCTGCAAAAAATCCGCTACTACCACAACGACCTCAACGGTTTGCCCGAACG
CCTCACCGAGAGCGACGGCCATACGGTATGGCAAGCGCGCTATGAAGTCTGGGGCAATACCGTCGAGGAA
AGCCGAGAACCCTATTTCATCGAAGAACAGAACCTGCGCTTCCAGGGCCAGTATCTGGACCGGGAAACGG
GGCTGCACTACAACACTCTGCGCTTTTATGACCCGGATATCGGGCGCTTCACCACACCCGACCCCATCGG
TCTGGCCGGCGGCCTGAATCTCTATCAATATGCGCCCAACCCGCTGAGCTGGATTGACCCGCTGGGCCTG
ATGAAATGCTCCAGCCCACCCAAGGGGCGCAAAGTCAGTCGCACCGTGTATCGGTTCGAGGAACCGGGGC
GCATCGGGACCACTTGGCAGGCGCACAAGTGGAATGTGGAGTCCACACACCGCTACACCACCAAAGGCGT
CGGTGGGGTGTATGGCGCGAACTCACGGAAAACCGCGCTGGGCGAGGTCACGCACTGGAAGGTCGACCTG
TCCAAACGGGTGTTGGTCAGCAAGAAAGTGCAGCTCAATAATGTCTTGGACCTGACCCGCGCCGATGTGC
GCAAACAGCTAGGGGTCAGCCTTAAAAGCATCACCGGCTCGAAGTACACCGAGACCCATCAGATCGGCAA
CTGGGCCAAGGCCAACGGCTATGATGGAATCCTGGCGCCATCGGCACGCAACCCGACCGGCAGCAACTTG
ATCTCCTTTGCAGGTTTTTGA
 Primer design