SecReT6
Protein ID: 229605184
SecReT6 ID336
T6SS typei1
Gene symbol-
Locus tagVCD_000124
StrainVibrio cholerae MJ-1236
Repliconchromosome 2 [GenBank: NC_012667] [Browse all T6SS(s) in this replicon]
Location [Strand]137507..141052 [-]
ProductIcmF-related protein
NoteTssM
UniProt IDC3NYA0
KEGG IDvcj:VCD_000124
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.90E-93, Aligned region: 509..825
ImcF-related_N [PF14331], Evalue: 4.90E-81, Aligned region: 201..458
DUF1215 [PF06744], Evalue: 2.80E-38, Aligned region: 919..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|229605184|ref|YP_002875888.1| IcmF-related protein [Vibrio cholerae MJ-1236]
MWKFIVGIVRRLKPTVVAALPILLFTTFILLNVAIWWAGPWLEVAGYKPLESIMARVVASSLFTLGCLAV
WGIWQWRKLQAFKSEQKREEQLRQDPIKVYEQRQEVELNQVMLNMKQSLNKHNYLYALPWYLVLGLENAG
KTSLINRSGQNFVFSSVMRASGQKSENPYSFDWWIGDESVLIDPDGELLTQGNRSEENDGALERRLWLHF
VDWLDRTRSRRPLNGIVLALDVAHLATATASERKAYANLLRARLRELMETLSTRLPVYIALTKLDLLHGF
EPFFKHYTKSQREEVLGFTFSMDSVDNLDSWLEEFASEYTQFVSRVNGMLPHAVAAPMTLEERNAIYSFT
RQISGLKEILQQFFQEALASDQFSTSALVRGAYFTSVYQQGVPTNAFDDAASRRYGLSHAINTAQRAKNS
TVYFTQKLFTHIIYPEAGLASDNFRVAKNKRRLMGLSFVACSVATLLLAGTWHRNYLNNVQHADTVLTKV
NQYKEQFPTSRSLASQREVLDPLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPKVEETYLNLLETRF
LPLLMADTIVALNQAETDEEKLAVLRVYRMLVDKSGRYQDYVMDYFAKYWQKSFSGQRQIQEELLGHLDY
AMRHTDLTAERLNGDKGAEQVMRPYDKVIARAQVELGSMPNDQRVYRNLKLSAQTVLGPSVNLRSLIGPV
FDVVFEERVLNSSSLFIPQMLTKRGFDDYFMPQSESVSELALIDSWVLGQSKTAQFSEADKQALREKIRD
LYVADYTNTWRAALNEIDVKYFNDINDAVMVLENITSNLEPMQRLLRTLDDNTQLYSALPKDESALKELL
KSPKYKVASMIETPFADLNGMLKPVGSKPAYMTEVLASVDELKSYLKSIQDAPDVGMAALDATKARVKLV
NADPIYTLKRISSGLPKPLDSMMAKLADESWYVVKQEAIKHLEVRWTEDVYKTFQSKLAGRYPFNPASNK
DVALADFEAFFAPNGTLDNFYNQQLKMFIDENISVASDDSAQSIIRKEVLDQIKQAQKIREAFFNRKGIL
DVSFSVEPLSLSNNKRRSVLNVDGQFLAYSHGPRENVELIWPNTLRDSAVSKVTLIPTQTNMSPRSLQIQ
GPWAFFRLLDQGDVVSASQTSVDFKFIVDGGEMIYRINAEADANPFTERLFKSFKLSKTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>ref|NC_012667.1|:c141052-137507 IcmF-related protein [Vibrio cholerae MJ-1236]
ATGTGGAAATTCATTGTTGGAATAGTAAGGCGGCTTAAACCCACGGTGGTGGCAGCACTTCCCATTTTGC
TATTCACTACGTTCATTTTGCTGAACGTTGCCATTTGGTGGGCAGGCCCTTGGTTAGAAGTGGCTGGCTA
TAAACCGCTGGAGTCGATCATGGCTCGAGTTGTGGCAAGCAGTCTGTTTACTCTCGGCTGTTTAGCCGTG
TGGGGCATTTGGCAGTGGCGTAAGTTGCAAGCCTTCAAATCGGAGCAAAAGCGCGAAGAGCAACTGCGCC
AAGATCCGATCAAGGTGTATGAGCAGCGCCAAGAGGTTGAACTGAATCAGGTGATGCTCAATATGAAGCA
GAGCCTAAATAAACACAACTACTTGTATGCACTACCTTGGTATTTGGTTCTAGGTTTAGAAAATGCGGGT
AAAACCAGCCTGATCAACCGTTCTGGTCAGAACTTTGTCTTCTCTTCGGTCATGCGAGCTTCGGGACAAA
AAAGCGAAAACCCATACTCGTTTGATTGGTGGATTGGTGATGAATCTGTCCTGATTGATCCTGATGGTGA
GCTGTTAACGCAAGGCAATCGTAGTGAAGAAAATGATGGTGCGTTAGAGCGCCGCTTATGGTTGCATTTT
GTCGATTGGCTAGACCGCACTCGTAGCCGCCGCCCGTTAAACGGCATCGTGTTGGCGTTGGATGTGGCGC
ATCTTGCTACCGCCACCGCCTCAGAGCGTAAAGCTTATGCCAATTTGCTGCGTGCTCGTCTGCGTGAGTT
GATGGAAACCTTATCGACTCGTCTGCCGGTGTACATTGCACTGACTAAGCTCGACTTACTGCACGGTTTT
GAGCCTTTCTTTAAGCACTACACCAAAAGTCAGCGCGAAGAGGTGTTGGGTTTTACCTTCTCAATGGATT
CGGTAGATAACCTAGATTCATGGTTGGAAGAGTTTGCCAGTGAGTACACTCAATTTGTGTCACGAGTTAA
TGGCATGCTGCCGCATGCGGTCGCAGCGCCAATGACGCTTGAAGAACGTAACGCGATTTACAGCTTCACG
CGTCAAATCTCAGGTTTGAAAGAGATTTTGCAACAGTTTTTCCAAGAGGCTTTGGCGAGCGATCAATTCT
CAACGTCAGCGCTGGTGCGTGGTGCCTATTTCACGTCGGTTTACCAACAAGGTGTACCTACCAACGCTTT
TGATGATGCGGCTTCCCGTCGTTATGGTCTGTCTCATGCGATTAATACGGCGCAGCGCGCGAAAAACTCC
ACGGTCTATTTCACGCAAAAACTGTTTACCCACATCATTTATCCTGAAGCGGGTTTAGCGTCGGATAATT
TCCGGGTTGCAAAAAACAAACGCCGTTTGATGGGGCTCTCTTTTGTCGCATGCTCAGTGGCGACTTTGCT
GTTGGCGGGAACTTGGCATCGTAACTACCTCAATAACGTGCAACACGCCGATACTGTATTAACCAAAGTG
AATCAGTATAAAGAGCAGTTCCCGACCAGCCGTTCATTGGCCTCACAAAGAGAGGTATTGGATCCGTTGA
ACAAGATCCGTGAGGCGACACTGGAGTTTGGTTTCTTCCGTGATAAACCTCAGTACATCTCCGATTTTGG
TCTCTACCAAGGGCACACCATTGGCCCGAAAGTAGAAGAGACCTACTTAAACTTACTCGAAACTCGCTTC
TTGCCTCTGTTGATGGCGGACACCATTGTTGCGCTCAATCAAGCTGAGACAGATGAAGAAAAATTAGCGG
TGCTGCGTGTGTATCGCATGCTGGTCGATAAAAGTGGTCGTTACCAAGACTATGTGATGGATTATTTTGC
GAAGTATTGGCAAAAATCCTTCTCAGGTCAGCGTCAAATTCAGGAAGAGCTGCTCGGCCACTTAGATTAC
GCGATGCGTCATACGGACCTCACTGCAGAGAGGCTCAATGGTGATAAAGGGGCGGAGCAGGTGATGCGCC
CTTACGATAAAGTGATTGCTCGTGCTCAGGTTGAACTGGGTTCAATGCCAAACGACCAGCGCGTCTATCG
TAACTTGAAATTGAGCGCACAAACGGTGCTTGGTCCTTCGGTTAACTTGCGTAGCTTGATTGGGCCGGTG
TTCGATGTGGTGTTTGAAGAGCGCGTTCTTAACAGTAGCAGCCTGTTTATTCCTCAAATGCTCACCAAGC
GTGGTTTTGATGACTACTTTATGCCGCAATCTGAATCGGTCTCTGAGCTGGCACTGATTGACAGTTGGGT
TCTGGGACAGAGCAAAACGGCACAGTTTAGTGAAGCAGACAAGCAGGCACTGCGCGAAAAAATCCGCGAT
CTTTATGTGGCGGATTACACCAACACATGGCGCGCGGCACTCAATGAAATTGATGTGAAGTATTTCAATG
ACATCAATGATGCGGTCATGGTTTTGGAAAATATCACCAGTAACCTTGAGCCGATGCAGCGTCTACTGCG
CACATTAGATGACAACACCCAACTGTACAGTGCGTTACCTAAAGATGAATCGGCGTTAAAAGAGCTGCTG
AAAAGTCCGAAATACAAAGTGGCTTCGATGATTGAAACTCCGTTTGCTGATCTGAACGGTATGCTCAAAC
CGGTGGGCAGCAAACCAGCGTACATGACGGAAGTCTTGGCTTCGGTGGATGAGCTGAAAAGCTACTTGAA
ATCGATTCAAGATGCTCCCGATGTCGGTATGGCGGCGCTCGATGCGACCAAAGCGCGGGTCAAACTGGTT
AATGCTGACCCTATCTATACCTTAAAACGTATCTCGTCAGGACTGCCGAAGCCGCTGGATAGCATGATGG
CAAAGCTTGCAGATGAGAGCTGGTATGTGGTCAAGCAAGAAGCGATCAAGCATCTGGAAGTTCGCTGGAC
GGAGGATGTGTATAAAACCTTCCAAAGCAAGCTGGCTGGGCGTTATCCATTCAACCCCGCATCAAATAAA
GATGTTGCCTTGGCCGATTTTGAAGCCTTCTTTGCGCCGAATGGCACGTTAGACAACTTCTACAATCAGC
AACTGAAGATGTTTATTGATGAGAACATCAGCGTCGCGTCGGATGACTCAGCGCAGTCGATCATTCGTAA
AGAAGTGCTGGATCAGATCAAGCAAGCGCAGAAAATTCGTGAGGCTTTCTTCAACCGTAAAGGGATTTTG
GATGTCAGCTTCTCGGTTGAGCCGCTCAGTTTGAGTAACAACAAGCGTCGTAGTGTGCTGAATGTGGATG
GTCAGTTCTTAGCTTACAGCCATGGTCCGCGTGAAAATGTGGAGCTGATTTGGCCTAACACGCTGCGTGA
TTCTGCGGTGTCTAAGGTGACCTTGATTCCAACCCAAACCAATATGTCACCGCGCAGTTTGCAAATCCAA
GGACCGTGGGCATTCTTCCGCTTATTGGATCAAGGTGATGTGGTTTCGGCGAGTCAAACGTCGGTTGATT
TCAAATTTATCGTCGATGGCGGTGAGATGATCTACCGTATTAACGCAGAGGCCGATGCCAACCCATTTAC
CGAACGCCTGTTCAAGTCGTTCAAACTGTCTAAAACACTCTATTAA
 Primer design