SecReT6
Protein ID: 237806976
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0200
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]221430..222434 [+]
ProductFis family sigma-54 specific transcriptional regulator
NoteSfa2
UniProt IDC4L831
KEGG IDtau:Tola_0200
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 7.70E-70, Aligned region: 20..187
Sigma54_activ_2 [PF14532], Evalue: 1.10E-25, Aligned region: 21..191
Sigma54_activ_2 [PF14532], Evalue: 1.10E-25, Aligned region: 309..327
HTH_8 [PF02954], Evalue: 1.60E-09, Aligned region: 174..182
HTH_8 [PF02954], Evalue: 1.60E-09, Aligned region: 289..325
AAA_5 [PF07728], Evalue: 2.00E-06, Aligned region: 43..164
AAA [PF00004], Evalue: 4.30E-06, Aligned region: 44..162
AAA [PF00004], Evalue: 4.30E-06, Aligned region: 245..282
Mg_chelatase [PF01078], Evalue: 4.50E-05, Aligned region: 41..62
Mg_chelatase [PF01078], Evalue: 4.50E-05, Aligned region: 102..141
T2SE [PF00437], Evalue: 0.00072, Aligned region: 22..62
AAA_2 [PF07724], Evalue: 0.00093, Aligned region: 40..124
HTH_30 [PF13556], Evalue: 0.0093, Aligned region: 299..324
Protein Sequence: 334 a.a.     [Download]
>gi|237806976|ref|YP_002891416.1| Fis family sigma-54 specific transcriptional regulator [Tolumonas auensis DSM 9187]
MTITNNKAAQRQEPDNPYALIGSSQLMKQVYRLISKVLHSEANILLTGETGTGKELVARAIHEYGHRRTQ
PFVVQNCASLPDGLLESELFGYKKGAFTGADRNHLGMFDAAHNGILFLDEIGDLPLILQAKLLRVLQEQE
IRPLGDTQYHKINVRVIAATHRNLEEMVALGEFRSDLYYRLAHFPIELPPLREREGDIKKLAYSFLREIA
MRERRGEMRLSAAAEKALQNYDFPGNVRELKSMIERAILLADDTDTIECHHFPNIQGVISPESSPVHGGM
LKELVDHYERQVLIESLKKHHGNQKNTAIALGVARRTLLYKLSKHNINSRNWRA
 
Nucleotide Sequence: 1005 bp     [Download]
>ref|NC_012691.1|:221430-222434 Fis family sigma-54 specific transcriptional regulator [Tolumonas auensis DSM 9187]
ATGACAATTACAAATAATAAAGCCGCTCAGCGGCAAGAGCCGGATAACCCATACGCTTTAATTGGGAGCA
GTCAGTTGATGAAACAGGTTTATCGCCTGATTTCCAAGGTGCTTCATAGTGAAGCCAACATCCTTTTAAC
TGGTGAAACAGGCACCGGAAAGGAGTTGGTGGCTCGCGCTATTCATGAATATGGTCACCGACGTACACAG
CCTTTTGTTGTACAGAACTGCGCCAGCTTGCCTGACGGGCTATTGGAAAGTGAACTGTTTGGTTATAAAA
AAGGGGCATTTACAGGTGCCGATCGCAATCACCTAGGAATGTTTGATGCTGCTCATAACGGCATCCTGTT
TCTGGATGAAATCGGTGATCTGCCGTTAATACTGCAAGCGAAATTGTTGCGGGTGTTACAGGAGCAGGAA
ATTCGTCCACTGGGTGATACGCAGTATCACAAAATCAATGTCCGGGTGATTGCCGCAACGCATCGGAATC
TGGAGGAGATGGTTGCACTGGGGGAGTTCCGCAGCGATCTCTATTACCGGTTAGCTCATTTTCCTATTGA
GTTACCGCCGTTGCGGGAACGGGAAGGTGACATAAAGAAATTAGCCTATTCATTTCTCCGTGAGATTGCC
ATGCGTGAACGTCGTGGAGAAATGAGGTTGTCAGCCGCTGCTGAAAAAGCATTGCAGAATTATGACTTCC
CGGGAAATGTCCGCGAGCTGAAAAGTATGATTGAGCGAGCGATTTTGCTGGCTGATGATACCGATACCAT
TGAATGTCATCATTTCCCTAATATTCAGGGCGTTATATCACCGGAATCATCACCTGTACACGGTGGCATG
CTGAAAGAACTGGTCGATCATTATGAGCGGCAGGTGTTGATTGAAAGCCTGAAAAAACATCATGGTAATC
AGAAAAATACGGCTATTGCACTCGGTGTTGCCCGCCGGACACTGCTCTACAAACTCAGTAAACATAACAT
TAATTCCCGGAACTGGAGGGCATGA
 Primer design