SecReT6
Protein ID: 237806982
SecReT6 ID337
T6SS typei1
Gene symbol-
Locus tagTola_0206
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T6SS(s) in this replicon]
Location [Strand]226709..230230 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC4L8G6
KEGG IDtau:Tola_0206
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.80E-73, Aligned region: 88..131
ImcF-related_N [PF14331], Evalue: 2.80E-73, Aligned region: 196..453
IcmF-related [PF06761], Evalue: 2.70E-68, Aligned region: 502..794
DUF1215 [PF06744], Evalue: 5.10E-32, Aligned region: 697..728
DUF1215 [PF06744], Evalue: 5.10E-32, Aligned region: 912..1032
Protein Sequence: 1173 a.a.     [Download]
>gi|237806982|ref|YP_002891422.1| type VI secretion protein IcmF [Tolumonas auensis DSM 9187]
MKNLFRRLIHTLKQTWCWTLLLTFVGGALVFFIGPLIAIAGRTILAALETRIVVMILLLAFWLVALLVAQ
PLRKRRRRRMLNAEQLKTELENDEQIDDELHILKERLNNAIHVIKHASFYGKRRASRYELPWYLLMGDQN
SGKTALLENSGVDFPLNKTDERMTRDIGHTRYCDWYFANQAVMIDAGGRYMVQEENSVAERVWPQFLQML
YQKRRRRPLNGIVFTLDVGQLLNQDEGALEQYARTVRGRMQQIQSQLSSDIPVYLVLSKGDYLEGFNAFF
EHLTKEEREQIVGVTFKENSDGTQVDVLRTEFEELIRRINDMVLSRIHHERDVKRRGDIIRFPLQFAAIV
EPLALFVEIAFGRNRYHLPTRLRGIYLTSAPHIDVNQPLNETTVSIGRNIGLQRDLLPFTSPNRGFFIRR
VLEDIVFNEGDLATIDTRYDRGMRWTNRFACLCAFVVVLGIGSTWMRVFHDNSSRQQILRDLHMKVEHEQ
QKIPPVSDTPAVLPVLSTLRQATEIYPQSNRADWINKLSLHQGNRINPVVDKAYEQQLRQLMLPKIKLLL
EEQLRAGTDDRDYLLKALRAYLMLHDKPHLDNNYLRQWISLSWADLYSGQATLQKSLLDHFDKLLSIGFE
PLDIDYRLVEDTQHLLKQESPARLVYRMIKEDPLAVTLPAVHFDDVQGLQYHSFTGGDYGIPGLYTQRGY
QDVFLRKGLALIKDIMRDNWVLGTSDDMSEREFQKIYADVENLYFQDYISYWNEAIGQLQLKAMSDITDA
SNTLNNLNNNQPVQRVLALIRDNTLFKLSESIADEAENAVLKKTGKGKLAKALVAQAGSALEEAQNKGPK
QALALKFAPFHQLVQENGTPNPALQDAFTALNAIQSMFTALAHAPDQDAAAYQLASNRMSGQPDELTRIR
IAADRLPEPIRTWFIDIGDQTWRMTLDKAADYVQMQYRTDVLTVYDNTIKGRYPFADSDKDVTLGDFNEF
FKKDGVLDQFVSGPLKPFFLVRGGELLSRSIDGQSIRMSRSSLQQFQRAAQIQKAFFTEAGGQAGMNFKV
QPLELDPGALKSEFAYSGQSLIYQHGPIVPIDLRWPVAQGNGTANISMQDLNGRETLLTKQSGAWSLFRL
LDHCVVRTHDGEDQLVVIIDNQGVQAQYLFSGDHSPNPLKRTLLTGFALSDRL
 
Nucleotide Sequence: 3522 bp     [Download]
>ref|NC_012691.1|:226709-230230 type VI secretion protein IcmF [Tolumonas auensis DSM 9187]
ATGAAAAATCTCTTCCGCAGATTGATCCACACATTAAAACAAACATGGTGCTGGACGTTGTTGCTGACAT
TCGTTGGCGGTGCTCTGGTATTTTTCATCGGTCCGCTGATTGCGATCGCTGGCCGAACGATTCTGGCCGC
ACTGGAAACCCGCATAGTGGTCATGATCCTGCTGCTGGCTTTCTGGCTGGTCGCTTTGCTGGTGGCACAG
CCACTGCGGAAGCGTCGTCGTCGCCGGATGCTCAATGCGGAACAGCTGAAAACAGAACTGGAAAACGATG
AGCAGATCGATGATGAGTTACACATACTGAAAGAACGGTTAAACAACGCAATCCATGTCATAAAACATGC
CAGTTTTTATGGCAAGCGCCGAGCCTCCCGTTATGAATTACCCTGGTATCTGCTGATGGGAGATCAAAAC
AGCGGGAAGACGGCATTACTGGAAAATTCCGGGGTTGATTTTCCGCTGAATAAAACCGATGAGCGTATGA
CCCGGGATATCGGGCATACCCGCTACTGCGACTGGTATTTTGCCAATCAGGCCGTGATGATTGATGCCGG
TGGCCGTTATATGGTACAGGAAGAAAATTCAGTCGCTGAGCGGGTCTGGCCGCAATTCCTGCAAATGCTT
TATCAGAAGCGCCGTCGTCGCCCGCTGAACGGGATTGTGTTTACGCTGGATGTAGGACAATTACTGAATC
AGGACGAAGGTGCTCTGGAACAATATGCCCGTACTGTTCGTGGCCGGATGCAGCAAATCCAGTCACAACT
CAGCTCGGATATCCCGGTTTATCTGGTGCTGAGTAAAGGCGACTATCTGGAGGGATTTAATGCCTTCTTT
GAGCACCTGACCAAAGAAGAACGGGAACAGATTGTCGGGGTTACTTTCAAAGAAAACAGTGATGGTACTC
AGGTCGATGTATTACGCACTGAATTTGAAGAGCTGATCCGTCGTATCAACGATATGGTGTTATCGCGTAT
TCATCACGAACGGGATGTGAAACGACGTGGCGATATTATCCGTTTCCCGCTGCAATTTGCGGCGATAGTA
GAACCATTGGCTCTGTTTGTTGAAATTGCCTTTGGCCGTAACCGCTATCATTTACCCACCCGCTTACGTG
GTATCTATCTGACCAGTGCACCACATATTGACGTGAACCAACCGCTGAATGAAACCACGGTCAGCATTGG
TCGTAATATCGGTCTGCAGCGGGATCTTTTGCCATTCACTTCGCCAAACCGGGGTTTCTTTATTCGCCGG
GTGCTGGAAGATATTGTCTTTAATGAGGGGGATCTGGCGACTATTGATACCCGTTATGACCGTGGTATGC
GATGGACTAATCGTTTTGCCTGCCTGTGTGCTTTTGTTGTGGTGTTAGGCATCGGCTCAACCTGGATGCG
CGTATTCCATGATAACAGTTCCCGTCAGCAAATATTGCGCGATCTGCATATGAAAGTAGAACATGAGCAG
CAGAAAATACCGCCTGTATCGGATACGCCAGCCGTCTTACCGGTATTAAGTACATTGCGGCAAGCGACAG
AAATTTATCCGCAAAGTAACCGGGCTGACTGGATTAATAAACTCAGCCTGCATCAGGGTAACCGAATTAA
TCCGGTCGTGGATAAAGCCTACGAGCAACAACTGCGTCAGCTGATGCTGCCGAAAATTAAGCTGTTACTG
GAAGAGCAGTTGCGGGCAGGCACCGATGATCGTGATTACCTGTTAAAGGCGTTACGGGCATATCTGATGC
TGCATGACAAACCGCATCTGGATAATAACTACCTGCGTCAGTGGATCAGTTTGTCCTGGGCGGATTTATA
TAGCGGTCAGGCAACATTGCAAAAAAGTCTGCTGGATCATTTCGACAAATTGCTGAGTATTGGCTTTGAA
CCGCTCGACATTGATTATCGTCTGGTTGAAGACACGCAGCATCTGCTGAAACAGGAGTCTCCCGCCCGGC
TGGTTTACCGCATGATCAAGGAAGATCCGCTGGCGGTAACTTTGCCCGCTGTTCATTTTGATGATGTGCA
GGGACTGCAGTATCACAGTTTTACCGGTGGTGACTACGGCATTCCCGGGCTCTATACCCAGCGTGGATAT
CAGGATGTTTTCCTGCGGAAAGGATTAGCTTTAATTAAAGACATCATGCGTGATAACTGGGTTCTGGGGA
CCTCAGATGACATGAGCGAGCGGGAATTCCAGAAAATTTATGCCGATGTTGAAAATCTCTATTTTCAGGA
TTACATCAGTTACTGGAATGAAGCTATTGGCCAGTTGCAGCTGAAAGCGATGAGCGATATCACCGATGCC
AGTAATACGCTGAATAATCTGAATAACAATCAGCCTGTACAGCGGGTGCTGGCATTGATCCGTGATAACA
CGCTGTTCAAATTGTCAGAATCAATTGCAGACGAAGCTGAAAATGCCGTGCTGAAGAAAACCGGGAAGGG
CAAACTGGCCAAAGCACTGGTTGCGCAGGCTGGTTCGGCGCTCGAGGAAGCGCAGAACAAGGGACCGAAA
CAGGCGCTTGCACTGAAATTTGCGCCCTTCCATCAGCTGGTTCAGGAAAACGGGACGCCTAATCCGGCAT
TACAGGATGCATTTACAGCTCTGAATGCGATCCAGTCAATGTTTACTGCTCTTGCTCATGCACCGGATCA
GGATGCGGCAGCTTATCAGCTGGCAAGTAACCGTATGTCGGGACAACCAGATGAACTGACCCGGATCCGT
ATCGCTGCTGATCGGTTACCGGAACCTATCCGGACATGGTTTATTGATATCGGTGATCAGACCTGGCGTA
TGACACTGGATAAAGCCGCCGATTATGTACAGATGCAGTATCGCACCGATGTACTTACTGTTTATGACAA
CACCATCAAGGGACGTTATCCGTTTGCTGACTCGGATAAGGATGTAACTCTGGGTGATTTCAATGAATTC
TTCAAAAAAGATGGTGTTCTGGATCAGTTCGTTTCCGGCCCGCTGAAGCCGTTCTTTCTTGTGCGCGGTG
GCGAATTGCTGTCCCGTTCCATTGATGGACAAAGCATTCGCATGAGTCGTTCTTCGCTGCAGCAGTTTCA
GCGGGCAGCTCAGATCCAGAAAGCATTCTTTACGGAGGCTGGTGGCCAGGCCGGGATGAACTTTAAAGTT
CAGCCGCTGGAATTGGATCCCGGTGCGCTGAAGTCGGAGTTTGCTTATTCCGGGCAGTCACTGATTTATC
AGCATGGTCCGATTGTACCGATAGATCTGCGTTGGCCAGTGGCACAGGGTAATGGTACCGCCAATATATC
CATGCAGGATCTGAATGGTCGCGAAACGTTACTGACCAAACAGAGTGGGGCCTGGTCACTATTCCGGTTG
TTGGATCATTGCGTTGTCAGAACACATGACGGAGAAGATCAGCTGGTGGTCATCATCGATAATCAGGGTG
TTCAGGCTCAGTATCTGTTCTCCGGTGATCACAGCCCGAATCCGCTGAAACGCACGTTACTGACTGGTTT
TGCACTATCAGACCGTCTGTGA
 Primer design