SecReT6
Protein ID: 238023639
SecReT6 ID338
T6SS typei3
Gene symbol-
Locus tagbglu_2g01480
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]163266..167363 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC5ALD5
KEGG IDbgl:bglu_2g01480
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-88, Aligned region: 273..554
IcmF-related [PF06761], Evalue: 2.00E-84, Aligned region: 603..919
DUF1215 [PF06744], Evalue: 2.20E-29, Aligned region: 1057..1179
cobW [PF02492], Evalue: 0.005, Aligned region: 194..210
cobW [PF02492], Evalue: 0.005, Aligned region: 271..359
Protein Sequence: 1365 a.a.     [Download]
>gi|238023639|ref|YP_002907871.1| unnamed protein product [Burkholderia glumae BGR1]
MSHLNRFFKFLISRQTLVFVAIVAVAAAIWFIGPLIAFGDYRPLATVLARALSIVTLLAMLLFCLLGWSL
GVIGAALLCLAIWYLGPLFMFGSVRPLASTGVRVLLIAVLVACYAAYGLYRLWKAMRSNDALLQRILNPF
STQASDDAPAREQIRAVNSVVTKAIDKVKQLRGGAFGLRRLLESQRYLYALPWYLVMGSPGAGKTTMILN
SGLEFPDADQMVAASLGHHAETVNCDWWFGNDAILIDTAGRYLMHDMPARADEPDHAAGAVGSANAAEWR
GFLALLRKRRPRAPVNGVLLVVSVEELLTCSPSELKLLAAAMRARLGELKHDLRIRYPAYLVVTKLDLLP
GFLEYFQSLTAESRAQILGFTLPYHRDAPEERRDALRLACIEELRELEQGFEDGLNARLQEEYELDRRRR
LYALPAEFRSLCAILVEFVASVFVDSKYDDTELNGVLRGVYFSSAAQTHDVVPADRDTLLQRLRRGLAAR
FGADAAAVSAPAPDGAAPVEYRGYFLRNLFQRVIVAEGHLVRPNLRWEIRFRALRVVGHLLSIAVAAWLV
YGMAGSFQRNRDYLAAIDHQTNALAARVQAQRRTPKPGDTGALLSASLDLPRFGELDLDRPGIAWRYGLY
AAPGVVDASSRTYAALLDQMLLPPVVARIATVLDGEVRAQNADEVYKTLPVYLMLYDPSHYDAKEVKAWV
MRDWEQAGSVAMLGDRDVVAGHLDALFRDGVPVTPATPMDGALIKRARELLGRNSASGRLYERAMKAMEP
DAPENITLARAGGPQALSVFAMAGDPALAQGVPGLYTYEGYHEVFTRRLPEFLEQAHERDAWLMGRGDRS
STWGRAGRVLRAGERALADEIRRQYLIDYGNYWQRFLDGVRLASGGAAPALDLQMLRTLSAPDSPLVRLA
RTAARETSLATPDTQDGPSLAGSAAAIASRRSRAASAVLAIGGATSTINRLARRRMEHDLVEQRFAALRA
VVTGEADTDGGKLVRAWSASASLSSLPSLPSPGGGGPMQLDGIVSLIGERYTRLVLAGDVLATDSMPPAD
DLGATMRLEAEKLPAPFRAVLAGLAERSTQEVNRKMGALLGSRLEANVGDPCRSLIEGRYSFADSAQEVS
IADFNRVFAAKGLLDKFFRETLADHVDTGSHPWRYRPAAPGMPPMRGPSLEPFERAAAIRRAFFLGPGAS
RLVWKLGIRVVSLDPDITELRLDIDGQSLRYAHGPVTTFPVTWPGPRGGSMAGITAEPQVSAQSSTLGAE
GPWALFRLFDRGRLVPTSDTSRYTEDFDFDGRHAVLELNTGGRAGGEPIGLLKGFRCPGFGGVTGGMTAA
ATSAPRSAAAAPAGEADDAGEGTRGSEPPTEAAFD
 
Nucleotide Sequence: 4098 bp     [Download]
>gi|339717964|ref|NC_012721.2|:163266-167363 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGTCCCATCTGAACCGCTTCTTCAAATTCCTCATCTCGCGTCAAACGCTCGTGTTCGTGGCGATCGTGG
CGGTCGCCGCGGCCATCTGGTTCATCGGCCCGCTTATCGCGTTCGGCGACTATCGTCCTCTCGCGACGGT
GCTGGCGCGCGCGCTGTCGATCGTCACGCTGCTAGCGATGTTGCTGTTCTGTTTGCTCGGTTGGTCGCTC
GGCGTGATCGGGGCCGCGCTGCTTTGCCTCGCGATCTGGTATCTCGGGCCGCTGTTCATGTTCGGCTCCG
TGCGGCCGCTGGCGTCGACGGGCGTGCGCGTGCTGCTGATCGCGGTGCTGGTGGCCTGTTACGCGGCCTA
CGGCCTGTACCGGCTCTGGAAGGCAATGCGCAGCAACGACGCGCTGCTGCAGCGCATCCTGAACCCGTTC
TCCACCCAGGCTAGTGACGACGCGCCGGCGCGCGAGCAAATCCGCGCTGTCAACTCGGTGGTGACGAAGG
CCATCGACAAGGTCAAGCAACTGCGCGGTGGGGCGTTCGGCCTGCGCCGGCTGCTCGAAAGCCAGCGCTA
TCTGTACGCGTTGCCATGGTATCTGGTGATGGGTTCGCCGGGCGCGGGCAAGACCACGATGATCCTGAAT
TCCGGCCTCGAGTTTCCCGATGCCGATCAGATGGTGGCGGCCTCGCTCGGCCACCACGCCGAAACGGTGA
ATTGCGATTGGTGGTTTGGCAACGACGCGATCCTGATCGACACGGCGGGCCGTTACCTGATGCATGACAT
GCCGGCACGAGCCGATGAGCCCGACCACGCCGCCGGCGCGGTGGGATCGGCGAATGCCGCCGAATGGCGC
GGCTTCCTCGCTCTGCTGCGCAAGCGCCGGCCCCGCGCGCCGGTCAATGGCGTGCTGCTGGTGGTCTCGG
TCGAGGAACTGCTGACGTGCTCGCCGTCCGAGCTCAAGCTGCTCGCCGCGGCGATGCGCGCGCGGCTCGG
CGAGCTGAAGCACGATCTGCGGATTCGCTACCCTGCCTATCTGGTGGTCACGAAGCTCGACCTGCTGCCG
GGCTTTCTCGAGTATTTCCAGTCGTTGACGGCGGAGAGTCGCGCGCAGATTCTCGGGTTTACGCTGCCCT
ATCATCGCGACGCGCCCGAGGAGCGGCGCGACGCGTTGCGTCTGGCCTGTATCGAGGAGCTGCGTGAACT
GGAACAAGGTTTCGAAGACGGCCTCAACGCGCGGCTGCAGGAGGAATACGAGCTCGATCGGCGTCGAAGG
CTTTATGCGTTGCCGGCGGAATTTCGCAGCCTATGCGCGATACTGGTCGAATTCGTCGCGTCCGTGTTCG
TCGATTCGAAATACGACGATACCGAGCTGAACGGCGTGCTGCGCGGCGTATATTTCAGTAGTGCGGCGCA
GACTCACGACGTGGTGCCTGCCGATCGCGACACGCTGCTGCAACGTCTGCGGCGAGGGCTGGCGGCCCGC
TTCGGCGCGGATGCCGCAGCGGTCTCCGCACCGGCGCCGGACGGCGCCGCGCCCGTCGAGTATCGCGGCT
ATTTCTTGCGCAACCTGTTCCAACGCGTGATCGTTGCCGAAGGGCATCTGGTGCGCCCGAATCTGCGCTG
GGAAATCCGCTTTCGCGCGTTGCGGGTGGTCGGCCATCTGCTGTCAATCGCGGTAGCGGCTTGGCTCGTG
TATGGGATGGCCGGCAGTTTCCAGCGCAATCGCGACTATCTCGCTGCGATCGACCACCAGACGAATGCGC
TCGCCGCGCGCGTGCAGGCACAGCGCCGGACGCCGAAGCCGGGTGACACGGGCGCACTGCTGTCGGCGTC
GCTCGATTTGCCTCGGTTCGGTGAGCTCGACCTTGATCGCCCCGGCATCGCGTGGCGCTACGGGCTGTAC
GCGGCCCCCGGCGTGGTCGATGCTTCGAGCCGAACCTATGCGGCGCTGCTCGACCAGATGCTGCTGCCGC
CCGTCGTTGCCCGTATTGCGACGGTGCTCGACGGCGAGGTGCGCGCGCAGAACGCCGACGAGGTCTACAA
AACCCTGCCGGTCTATCTCATGCTCTACGATCCTTCGCACTACGATGCGAAGGAGGTCAAGGCCTGGGTG
ATGCGAGACTGGGAGCAGGCGGGCAGCGTCGCGATGCTGGGCGATCGCGATGTGGTGGCGGGCCATCTCG
ACGCGCTGTTTCGCGACGGTGTGCCCGTGACGCCCGCCACGCCGATGGACGGCGCGCTGATCAAGCGTGC
GCGCGAGCTGCTAGGCCGCAATTCGGCCTCGGGGCGGCTCTACGAGCGCGCAATGAAGGCGATGGAGCCC
GATGCACCCGAGAACATCACGCTGGCCCGCGCGGGCGGCCCGCAGGCGCTGTCGGTGTTCGCGATGGCCG
GCGACCCGGCCCTCGCGCAGGGAGTGCCGGGGCTCTATACCTACGAGGGCTATCACGAGGTTTTTACGCG
GCGCCTGCCCGAATTTCTCGAGCAGGCGCATGAACGGGACGCATGGCTCATGGGGCGGGGCGATCGATCG
TCGACATGGGGGCGTGCGGGCCGTGTACTGCGTGCCGGCGAGCGGGCGCTCGCCGACGAGATCCGCCGTC
AGTACCTGATCGATTACGGGAATTACTGGCAGCGCTTTCTCGACGGCGTGCGGCTCGCTTCCGGCGGCGC
TGCACCGGCGCTCGACCTGCAGATGCTGCGGACGCTTTCCGCGCCCGATTCGCCGCTCGTCAGACTGGCA
CGCACGGCCGCTCGCGAGACCTCGCTCGCGACGCCCGATACGCAGGACGGCCCATCGCTGGCCGGCAGCG
CCGCGGCCATCGCGTCGCGGCGCTCGCGCGCCGCCTCGGCCGTGCTCGCGATCGGCGGCGCCACCTCGAC
GATCAATCGGCTGGCGCGACGCAGGATGGAGCACGATCTGGTCGAGCAGCGCTTCGCCGCCTTGCGTGCC
GTCGTCACGGGCGAGGCCGACACCGATGGCGGCAAGTTGGTGCGGGCTTGGTCGGCATCGGCCTCGTTGT
CGTCGCTGCCGTCGCTACCTTCGCCGGGAGGCGGCGGGCCGATGCAGCTCGACGGCATCGTCAGCTTGAT
CGGCGAGCGCTATACACGCCTCGTGCTGGCCGGTGACGTGCTCGCCACTGATTCCATGCCACCCGCCGAC
GATCTGGGTGCCACGATGCGGCTCGAGGCCGAAAAGTTGCCGGCACCGTTTCGCGCTGTACTGGCTGGTT
TGGCCGAGCGCTCCACCCAGGAGGTCAATCGCAAGATGGGCGCGCTGCTCGGTTCGCGGCTGGAGGCCAA
CGTGGGCGATCCGTGTCGCAGCCTGATCGAAGGCCGGTATTCGTTCGCGGACAGCGCGCAGGAGGTCAGC
ATCGCCGATTTCAACCGCGTGTTCGCCGCGAAGGGCCTGCTCGACAAGTTCTTTCGCGAGACCCTTGCCG
ACCACGTCGATACGGGTAGCCACCCATGGCGCTATCGGCCGGCCGCTCCCGGGATGCCACCGATGCGCGG
GCCGAGCCTCGAGCCGTTCGAGCGCGCCGCCGCGATCCGCAGGGCGTTCTTCCTCGGTCCGGGCGCGAGC
CGGCTGGTCTGGAAACTTGGCATCCGGGTGGTGTCGCTCGATCCCGATATTACTGAACTGCGTCTCGATA
TCGACGGGCAGAGCCTGCGTTACGCGCATGGCCCGGTCACCACCTTCCCGGTCACCTGGCCGGGACCGCG
CGGTGGCTCGATGGCTGGCATCACGGCAGAGCCGCAGGTTAGCGCGCAGAGTTCGACGCTTGGCGCGGAG
GGGCCGTGGGCGCTCTTCCGCCTGTTCGATCGCGGCCGTCTGGTGCCGACATCGGACACGTCGCGCTACA
CCGAGGATTTCGATTTCGACGGCCGGCACGCGGTGCTCGAACTGAACACTGGCGGCCGGGCCGGAGGGGA
GCCGATTGGATTGTTGAAGGGGTTTCGCTGCCCGGGCTTCGGTGGCGTGACCGGCGGGATGACAGCGGCC
GCCACCTCGGCTCCGCGGTCCGCTGCGGCGGCACCGGCGGGCGAAGCGGATGACGCTGGAGAGGGCACAC
GCGGCTCGGAGCCGCCCACCGAGGCGGCGTTCGATTAA
 Primer design