SecReT6
Protein ID: 238023696
SecReT6 ID339
T6SS typei2
Gene symbol-
Locus tagbglu_2g02210
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]257170..260691 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDC5ALJ2
KEGG IDbgl:bglu_2g02210
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.30E-75, Aligned region: 254..308
IcmF-related [PF06761], Evalue: 9.30E-75, Aligned region: 412..732
DUF1215 [PF06744], Evalue: 1.50E-34, Aligned region: 246..264
DUF1215 [PF06744], Evalue: 1.50E-34, Aligned region: 867..985
Protein Sequence: 1173 a.a.     [Download]
>gi|238023696|ref|YP_002907928.1| unnamed protein product [Burkholderia glumae BGR1]
MNRKFKIDLLGSILCVVLPGLIIWSRPQWVGLSAEQRGPAIAVLCIVFVVLLLAFSFSDSSRPAIAWRAV
KQWARDRGLLDRSTSAGAQPDDARSRAAALKQLLADRHFWRWRYRERWVLVAGDVPLVKRLAPGLVEAGY
LITGDAVLLYAQQTRDTLETDWLDQIRRLRRRRPVDAIVVVTCNRSSANAPFDTDALAQQLARHARALRW
AAPAYLLNVTDFGSETSSPDEAIGFTWANARISADQIDASLQDLAYNLADAGVVRLAKDAADRYPAELSQ
HISTLHGPLSGLVLQTAQSRIWRQAIHGLLFAPLVEERERAPLLPTDANDDEPAGEPRHRTIWQTVAEHS
RRIHGRRVGFSPSTTAAWITTGLVGCWIAGTMLSGFVNRATIRNVADTIARLSTVQDRTQALQALNGLDR
QIDTLEVHQRDGAPWSTRFGLNRDGALLDALWPGYANAASRILVAPIRQKLEARLRKLASLSDAQIASGG
NAQVQAVYDTLKAYLMLARPERAVAAFLTPQLVATAAPVRPANSPLSSGAWEDLRQHTIAFLASHLGRGR
WQAMAPDLGLVASTRQTVIGVRGIQNSTDAVYQQILDDAKAKYPPVSLATLLGDTTSRGLFDTTAAVPGV
FTRAAWDERISKAIDKASEQQNVAGDWVLSDVKATQSAPSRLKAQLRQRYFDDYGRAWALFLNSLRWQAA
PTLSATADQLTLLGDPQRSPLVALMNAIVYQAGAGANAQSLADNLISKAQQLVGGAEKDPSKQTQPPLAP
LAKAFGPILRLTGSDLVLGAAASGKAAAPLAATGDLSLARYLERVTAMRLKASQIVSGADPDAMARQAAQ
AVLQGRTSDIAESRDYASRLAASLGEQWSGFGELFRAPFDQAWQVVVQPAASSLNDMWRTAIVADWTRTF
GGRYPFADSDNDASLPEMARFMRPDNGVIAQFVTTQLAGVVERQGDRWVAVQGADHGALTIDPGFLASLN
QLTRVSTMLFPSGDAHLRYELRPEPTPGITDMKFVLSGRELRYFNQKQEWTPFEWPGQSLENLSHIEWQT
EQGGLRTALDSQGRFGLIRLLERAKVSQQDSARYLLSWTPDTSLGLPLRVQLRSEVGSGPLEVLELRHYT
LPARIFVTGATKAGPKLSATNLPLQPPPLPPAAIAAAKHAAMPLPHGTLPEVE
 
Nucleotide Sequence: 3522 bp     [Download]
>gi|339717964|ref|NC_012721.2|:257170-260691 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAACAGAAAATTCAAGATCGACCTTTTGGGTAGCATTCTTTGCGTTGTTCTGCCCGGGCTGATTATCT
GGTCGAGGCCGCAGTGGGTGGGTCTATCGGCCGAGCAACGCGGCCCGGCAATTGCTGTGCTGTGCATTGT
GTTCGTCGTACTGCTACTTGCATTCAGCTTCAGCGACTCCTCCCGTCCCGCGATTGCATGGCGGGCTGTC
AAACAATGGGCGCGCGACCGGGGACTTCTCGATCGTTCCACATCGGCCGGCGCACAACCGGACGACGCAC
GGTCGCGGGCAGCGGCGCTCAAGCAATTGCTTGCCGACCGTCACTTCTGGCGCTGGCGCTATCGCGAACG
GTGGGTACTCGTCGCCGGTGACGTGCCGCTGGTGAAACGCCTGGCGCCGGGACTCGTCGAGGCCGGGTAT
CTGATTACCGGCGACGCGGTCTTGCTGTACGCGCAGCAAACCCGCGACACACTAGAAACGGACTGGCTCG
ATCAAATCCGCCGCCTGCGCCGCCGTCGTCCGGTCGACGCGATCGTGGTCGTGACGTGCAATCGCAGTTC
AGCCAATGCTCCGTTCGACACCGACGCGCTTGCCCAACAGCTCGCGCGCCATGCCCGTGCGCTGCGCTGG
GCCGCGCCCGCGTATCTGCTCAACGTCACCGATTTCGGCAGCGAAACGTCGAGTCCCGACGAGGCGATCG
GGTTCACGTGGGCGAACGCGCGCATCAGCGCGGATCAGATCGACGCATCGTTGCAAGACCTCGCTTACAA
CCTGGCCGATGCCGGCGTCGTGCGGCTGGCGAAGGATGCCGCCGACCGCTATCCCGCCGAGCTCTCGCAG
CATATTTCGACGCTGCACGGCCCACTGTCCGGGTTGGTGCTGCAGACTGCCCAATCCCGCATCTGGCGGC
AGGCGATTCACGGGCTGCTTTTCGCACCGCTCGTCGAGGAACGGGAGCGGGCACCGTTGTTGCCCACCGA
CGCAAACGACGACGAGCCGGCGGGTGAACCTCGACATCGCACGATCTGGCAGACCGTCGCCGAACACAGC
CGCAGAATCCACGGCCGCCGCGTCGGCTTCTCGCCGTCGACGACAGCGGCCTGGATCACGACCGGCCTGG
TCGGCTGCTGGATCGCCGGCACGATGCTGTCGGGATTCGTCAACCGTGCAACGATCCGGAACGTGGCCGA
TACCATTGCGCGGCTGTCGACCGTTCAGGATCGCACGCAGGCCTTGCAAGCGCTCAACGGCCTCGACCGG
CAGATCGATACGCTCGAAGTCCATCAGCGCGACGGCGCGCCGTGGAGCACGCGCTTCGGCCTGAACCGCG
ACGGCGCGCTGCTCGATGCGCTATGGCCGGGCTATGCCAATGCGGCGAGCCGCATCCTCGTGGCGCCGAT
CCGCCAGAAGCTCGAGGCGCGCCTGCGCAAGCTTGCCTCCCTGTCGGATGCCCAGATCGCCAGCGGCGGC
AATGCGCAGGTGCAGGCCGTCTACGACACGCTGAAGGCTTACCTGATGCTCGCCAGGCCAGAACGGGCGG
TCGCCGCATTCCTGACTCCGCAACTCGTCGCGACGGCCGCGCCCGTGCGCCCCGCGAACTCGCCGCTGTC
GTCGGGGGCGTGGGAAGACCTGCGCCAGCACACGATCGCGTTCCTGGCGAGCCATCTGGGCCGCGGAAGG
TGGCAGGCGATGGCGCCGGATCTGGGGCTGGTGGCCTCGACGCGCCAGACGGTGATCGGCGTGCGCGGCA
TCCAGAACTCGACCGATGCGGTCTATCAGCAGATCCTCGACGACGCGAAGGCCAAGTATCCGCCTGTCTC
GCTCGCGACGCTGCTGGGCGACACGACCAGCCGGGGCCTATTCGATACGACGGCGGCCGTGCCGGGTGTG
TTCACACGCGCCGCCTGGGACGAGCGGATTTCGAAAGCGATCGACAAAGCGAGCGAGCAGCAAAACGTGG
CGGGCGACTGGGTGCTCTCCGACGTCAAGGCGACGCAGTCCGCACCGTCAAGGCTGAAGGCCCAGCTGCG
CCAGCGCTACTTCGACGATTATGGACGGGCCTGGGCGCTGTTCCTCAACAGCCTGCGCTGGCAAGCGGCG
CCGACGCTGTCCGCCACGGCCGACCAGCTCACGCTGCTGGGCGACCCGCAACGCTCGCCGCTCGTCGCGC
TGATGAACGCGATCGTCTACCAGGCGGGTGCCGGCGCGAATGCGCAGTCGCTCGCCGACAATCTGATCAG
CAAGGCGCAGCAGCTCGTCGGCGGCGCCGAGAAGGATCCGTCGAAGCAGACCCAGCCGCCGCTCGCGCCG
CTTGCCAAGGCGTTCGGGCCGATCCTGCGCCTGACCGGCAGCGATCTGGTGCTAGGCGCAGCTGCGAGCG
GCAAGGCCGCCGCACCGCTTGCCGCGACCGGCGACTTGAGCCTCGCACGATACCTGGAGCGCGTTACCGC
CATGCGCCTGAAGGCCTCGCAGATCGTCTCCGGTGCCGATCCGGACGCGATGGCGCGTCAGGCGGCGCAG
GCGGTCCTGCAAGGCAGGACGTCCGACATCGCCGAGAGCCGCGACTACGCCAGCCGCCTCGCCGCGAGCC
TGGGCGAGCAGTGGTCCGGGTTTGGCGAGCTGTTCCGCGCGCCGTTCGACCAGGCCTGGCAAGTTGTCGT
GCAGCCGGCGGCGTCGAGCCTGAACGACATGTGGCGCACCGCAATCGTGGCGGACTGGACCAGGACCTTC
GGCGGCCGCTATCCGTTCGCCGACTCCGACAATGACGCGTCGCTGCCCGAAATGGCGCGCTTCATGCGGC
CCGATAACGGCGTGATCGCGCAGTTCGTCACCACTCAGCTTGCCGGCGTGGTCGAGCGGCAGGGTGACCG
ATGGGTGGCGGTGCAGGGGGCCGACCACGGTGCGCTGACGATCGATCCCGGCTTCCTCGCCAGCCTGAAC
CAGCTCACCCGTGTCTCGACCATGCTGTTCCCGTCCGGGGACGCGCACCTGCGATACGAGTTGCGGCCGG
AGCCGACGCCGGGCATCACGGACATGAAGTTCGTGCTGTCCGGGCGCGAGCTGCGCTACTTCAACCAGAA
GCAGGAATGGACGCCGTTCGAGTGGCCCGGGCAGTCGCTGGAGAACCTGTCGCACATCGAATGGCAGACC
GAGCAGGGCGGGCTGCGCACGGCGCTCGATTCGCAGGGCCGGTTCGGCCTGATCCGGCTGCTGGAACGTG
CGAAAGTCTCGCAGCAGGACAGCGCGCGCTATCTGCTGAGCTGGACGCCGGACACGAGCCTCGGGCTGCC
GTTGCGCGTGCAACTGCGCAGCGAGGTCGGCTCGGGGCCGCTGGAGGTGCTGGAACTGCGGCACTACACG
CTGCCCGCCCGGATCTTCGTCACGGGCGCGACGAAGGCGGGGCCGAAGCTCTCGGCCACGAATTTGCCAC
TCCAGCCGCCACCATTGCCGCCGGCCGCGATCGCGGCGGCCAAACATGCCGCGATGCCGCTACCACACGG
CACATTGCCGGAGGTCGAGTGA
 Primer design