SecReT6
Protein ID: 238024044
SecReT6 ID340
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g06000
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]724205..727768 [+]
ProductImcF-like protein
NoteTssM
UniProt IDC5AMJ0
KEGG IDbgl:bglu_2g06000
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.40E-59, Aligned region: 450..780
DUF1215 [PF06744], Evalue: 2.40E-31, Aligned region: 909..1027
Protein Sequence: 1187 a.a.     [Download]
>gi|238024044|ref|YP_002908276.1| unnamed protein product [Burkholderia glumae BGR1]
MMNARNNMQILGTAEAETTETSRLLAWGPIFLALILAGVAFALVWFKGALFGVLTREAKLGASVWIFLAL
VAVLLLHIGLLFGGAYRLVGRVFRAEVGDRDAAVTQTKTLKCDARLQTVCDELRATRGWWWRYRTRWLLL
TGTDALIEDVAPGLKRAGVMPVADAILVHAAPDGIDVGAWRRQIRQLRRRRPVDSVVHVTDANAPETELP
RALATLATDLGWAAPVTLLHAVPATGGHPETFEAIGAFPGPSLGGTQPASVLREQLAVIGRHTADAGVRL
CVTPTRITYLAQISQYIDEQRESIISGWNALFASHWYRSRLAGVIFAPVFETSAAVPTPVPVVPIAPAGA
EAAAVVPTGTQQPVMFQHQPAALLPAWRTIARRRDTGRRVGFYWPNVLAWFVTVAAVTWCAWMTVSFVGN
RQLAREARATANAAAEARPQTAVAWRAQLALQQLIEKLEYRQQHGAPWYLRGGLSRNDEVLAGLWPPYRI
AATRNLQTPVVQTIGDLLKAAGQTRADSLESQDTRSSTYNALKTYLMLGDPSRAEPAFLKRMLVSQWPRP
VEMPLGERDDTGLRLAGFYADHLKAHPGWRIGLNNGLVTSTRNMLVTQMGLASSDDTVYQGIIEEARGRY
ADASLETLLAGADARGLFTTSQTVPGIYTRAAWDGMIAAAINKAASERRTSGDWVLTGAPPAQTIGNMLS
RGAIRTAAVIDEKHAAEDLKQRLTARYFAEYTAAWQGMLNSVRWQPAANLNGSIEQLTRLADAQTSPLIA
LMKAIQYQAQAGRPSQALADTLVRKAQSLIGRDDQAAAPTVNPLDKSFGPLLALMGDTAAVPAAGGKGNP
AANIALNGVSLSRYLTAVTTMRLKLQQIAGSPDAQTMARSLAQAVFQGKLSELSQARDDAALTAASLGTA
WSGFGDAVFAQPLEAAWQTILQPAAASLNEAWRASVAAPFNAAMSGRYPFFDTNADASFAELGRYVRPDT
GLIARFFATQLAGVLKLEGDHWTPNELAPQALQFDPTFLTGIRQLSTVGAQLYVQGDARERFEMMALPTP
NVTRSELSVDGKQIVYFNQQENWTPLAWPGTGLNGHAGLTWQTLDAGLRQAFDSTGDWAFLRLLAKADMK
QLDSTRYQVTWNTANAEPLSYVMRTQIGAGPLELLKLRGFRMPERIFIVGKAGVVPVLPPLPPELQP
 
Nucleotide Sequence: 3564 bp     [Download]
>gi|339717964|ref|NC_012721.2|:724205-727768 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGATGAACGCTCGCAATAACATGCAGATTCTCGGGACGGCCGAGGCTGAGACGACCGAAACCAGCCGGC
TGCTCGCCTGGGGTCCCATATTTCTGGCACTGATCCTGGCCGGGGTCGCGTTCGCGCTTGTGTGGTTCAA
GGGTGCGCTGTTTGGCGTGCTCACGCGCGAGGCGAAGCTCGGCGCATCGGTCTGGATTTTCCTGGCGCTC
GTGGCGGTGCTTCTGTTGCACATAGGGCTGCTGTTCGGTGGCGCATACCGCCTCGTTGGGAGGGTGTTTC
GCGCCGAAGTCGGCGATCGGGACGCCGCAGTAACGCAGACGAAAACGCTCAAGTGCGACGCTCGCCTGCA
GACCGTCTGTGATGAACTGCGCGCCACGCGCGGCTGGTGGTGGCGTTATCGAACGCGTTGGCTGCTTTTG
ACCGGCACGGACGCTCTGATCGAAGATGTCGCGCCCGGCCTGAAGCGCGCGGGTGTAATGCCCGTTGCCG
ACGCGATCCTTGTGCATGCCGCACCGGATGGCATCGATGTCGGGGCATGGCGCCGCCAGATCCGGCAGCT
ACGCCGCCGACGTCCCGTCGACAGCGTCGTCCATGTCACTGACGCAAACGCACCCGAAACCGAACTACCG
CGCGCACTGGCCACGCTTGCGACGGATCTGGGATGGGCTGCGCCCGTCACGCTCCTGCACGCGGTGCCGG
CCACGGGCGGCCACCCCGAGACGTTCGAGGCAATCGGCGCGTTCCCGGGTCCGTCGCTCGGCGGCACGCA
ACCGGCTTCGGTATTGCGCGAGCAGCTCGCCGTGATCGGGCGGCATACGGCGGACGCTGGCGTGCGGCTC
TGCGTCACGCCCACGCGGATCACCTATCTGGCCCAGATCTCCCAGTACATCGACGAGCAGCGCGAAAGCA
TCATCTCGGGCTGGAATGCCCTATTCGCCTCGCATTGGTATCGGTCCCGGTTGGCCGGCGTAATATTCGC
ACCTGTTTTCGAGACTTCCGCCGCAGTGCCAACGCCCGTTCCGGTGGTACCGATCGCGCCAGCCGGAGCA
GAAGCGGCGGCTGTCGTGCCGACGGGGACGCAGCAACCGGTGATGTTCCAGCACCAGCCTGCCGCACTGC
TGCCCGCGTGGCGCACGATCGCGCGCCGGCGCGATACCGGCCGGCGGGTCGGCTTCTACTGGCCCAATGT
GCTGGCCTGGTTCGTGACTGTCGCCGCGGTCACGTGGTGCGCGTGGATGACCGTTTCGTTCGTCGGCAAC
CGGCAGCTCGCGCGCGAAGCGCGCGCAACGGCGAATGCCGCGGCCGAGGCCCGGCCTCAGACCGCAGTGG
CCTGGCGCGCGCAACTGGCGTTGCAGCAGCTAATCGAAAAGCTTGAGTATCGCCAGCAACACGGTGCGCC
GTGGTATTTACGCGGCGGACTCTCGCGCAACGACGAAGTGCTCGCCGGGCTCTGGCCGCCATACCGGATC
GCGGCGACCCGCAACCTGCAGACGCCCGTCGTGCAGACGATTGGCGACCTGCTCAAGGCTGCTGGTCAGA
CCCGGGCCGACAGCCTCGAGTCGCAGGATACGCGTAGCAGCACCTACAACGCGCTCAAGACGTACCTGAT
GCTCGGCGATCCGTCGCGTGCTGAACCTGCGTTCCTCAAACGCATGCTGGTATCCCAATGGCCGCGCCCG
GTCGAGATGCCCTTGGGCGAGCGCGATGACACCGGCCTGCGGCTTGCTGGTTTCTATGCCGATCACCTCA
AGGCGCATCCTGGATGGCGCATCGGATTGAACAACGGTCTCGTGACGTCGACCCGCAATATGCTGGTCAC
ACAGATGGGGCTCGCGTCATCTGACGACACGGTCTATCAAGGCATCATCGAGGAGGCGAGAGGCAGGTAC
GCGGACGCGTCGCTTGAAACGCTGCTCGCTGGCGCGGACGCTCGAGGTCTGTTCACGACCTCGCAGACCG
TGCCAGGTATTTATACCCGTGCCGCCTGGGACGGAATGATCGCCGCAGCGATCAACAAGGCTGCGAGCGA
GCGTCGCACGAGCGGCGACTGGGTGCTGACCGGCGCCCCGCCGGCGCAAACCATCGGCAATATGCTGTCA
CGGGGTGCCATCAGAACCGCAGCCGTGATCGACGAAAAGCATGCGGCCGAGGACCTGAAACAGCGCCTGA
CAGCGCGGTACTTCGCCGAGTACACGGCAGCCTGGCAGGGCATGCTCAACAGCGTCCGCTGGCAGCCGGC
GGCGAACCTGAACGGCTCGATCGAGCAACTGACACGCCTCGCCGACGCACAGACATCGCCGCTCATCGCA
CTGATGAAGGCGATTCAATACCAGGCACAGGCAGGACGGCCGTCGCAGGCCCTGGCCGACACGCTGGTGC
GCAAGGCGCAGAGCCTGATTGGCAGGGACGATCAGGCGGCCGCGCCGACTGTCAACCCGCTCGACAAGTC
ATTCGGCCCGCTGCTCGCGCTGATGGGCGACACCGCTGCCGTACCGGCTGCAGGCGGCAAAGGCAACCCG
GCGGCCAATATCGCGCTGAACGGCGTGAGTCTCTCGCGGTACCTGACCGCAGTCACGACGATGCGCCTGA
AGCTACAGCAGATCGCAGGCAGTCCTGACGCGCAGACGATGGCGCGCTCGCTCGCGCAGGCGGTGTTCCA
GGGCAAGCTCTCGGAGCTGTCACAGGCACGCGACGACGCGGCGCTGACAGCCGCGAGTCTCGGGACGGCG
TGGTCCGGTTTCGGCGATGCGGTATTCGCGCAACCGCTCGAGGCCGCCTGGCAGACGATCCTGCAGCCGG
CTGCGGCAAGCCTGAACGAGGCGTGGCGGGCGAGCGTGGCGGCGCCGTTCAACGCGGCGATGAGCGGCAG
GTATCCGTTCTTCGACACGAACGCCGATGCGTCATTTGCCGAACTCGGGCGCTATGTGCGGCCCGACACG
GGCCTGATCGCACGCTTCTTTGCCACGCAGCTTGCTGGCGTGCTGAAGCTCGAGGGCGATCACTGGACGC
CGAACGAGCTGGCGCCGCAGGCGCTGCAGTTCGACCCGACGTTCCTGACTGGTATCCGGCAATTGTCGAC
CGTTGGCGCGCAGCTATATGTGCAGGGCGATGCGCGAGAGCGCTTCGAGATGATGGCACTACCGACGCCC
AACGTGACACGCTCGGAGTTGTCGGTTGACGGCAAGCAGATCGTCTACTTCAATCAGCAGGAAAACTGGA
CGCCGCTCGCGTGGCCCGGTACCGGCCTGAACGGGCACGCGGGGCTGACATGGCAGACACTCGACGCCGG
CCTTCGGCAAGCGTTCGATTCGACCGGCGACTGGGCGTTCCTGCGCCTTCTGGCCAAGGCCGACATGAAG
CAACTCGACAGTACCCGCTACCAGGTGACGTGGAACACGGCGAACGCCGAACCATTGTCCTACGTGATGC
GCACGCAGATCGGCGCAGGACCGCTCGAATTGCTGAAGCTGCGAGGCTTCCGGATGCCCGAGCGGATTTT
TATCGTCGGAAAGGCAGGTGTCGTGCCGGTACTGCCGCCTCTGCCACCGGAGCTTCAGCCATGA
 Primer design