SecReT6
Protein ID: 238024157
SecReT6 ID341
T6SS typeN/A
Gene symbol-
Locus tagbglu_2g07350
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]880140..884159 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC5AMV3
KEGG IDbgl:bglu_2g07350
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.40E-43, Aligned region: 171..415
DUF1215 [PF06744], Evalue: 4.90E-05, Aligned region: 719..745
DUF1215 [PF06744], Evalue: 4.90E-05, Aligned region: 1056..1115
Protein Sequence: 1339 a.a.     [Download]
>gi|238024157|ref|YP_002908389.1| unnamed protein product [Burkholderia glumae BGR1]
MDAILKSTAWLKAQTGWAPAAGTLKLVLGVLAALLALAVLAKLAGKLWARLGPLLKAPAVPPLCGCEPAA
ETRAKGWIERASLALDYLRTGREWRYATPWLLVLGQAGAGKTSLLESVGPQHTQPLGERQQSLALEGASW
HAIDQSLVLDPLGKWPEAAASAMLDSGTADGADARRWLKFLDQLDALRPERALDGIVLVVCATTFLQRDP
ARLMAAAQNARQQLRTIEDRLEFALPVYVVVTACDHVEGFGAFWRSQAPQRHTEMVGWSAPSQTFDTPPT
QWGAQIFAAIGAQLRALQVETAAHCERIAADDADPMFLYPLRFAQLQGPFEQWLSVVFQVSAWETTFFLR
GVYFTGLVAEPGEPLEARDGPRRDVAFVRDLMLEKVLAEKHLARPTRAGVWSRNLLIRRVQWACVIGFSL
LLLAFAVRVWMIDAQIGRVIQALERMQQLQAPAPGAGCIAQAPVYQLIEQVAQIDADASSWLLPASLFDS
RLSHQSARRVIDTALRKVILPGLACQLSQRAYALGNEANRGISAGLGYTQALDQLQGFVQQADQYERNAA
RFQRLLGKTPYARERVPLPGFFDLVEYAYRTPVPPYLRAHAGLLPVTLGDLTERDFSGEIATPPQLRQSV
GNHIVALAAQAGSLLQAELQSGLPLLEQLQARQQPILAHVRQFTHWLNWIRTAWLGSSAAANPILTVQNQ
LLASLQPLVADFGYPSYIQAQVSAQFDAAHQYPLAMQTLNALTLPGYGALFVNVNGQITLNPAMQGELTG
LDALGSLGYMSIDPLASFSCTGKLANWSQGLLKDAAQYPADYRKFLAQPMLKGGQPDALYRQLARYQLEL
AMNNQLAQAQAAAGYAASGTDTSTEAQQSADSGNFAAVAPLVLNVEQQFRALGMDGSATQLTQCAHQYAN
SQLGRISLLADQSQLYQPAYLPASPAPDAYFFDLGSTPVVTDMLARQVSRVQVLVGYAQPFLTYLGQAGP
SASNASANTANAAYWNNTASELRRYTQGKDPNSQPAVLDNLFLKLLPALQNDNCGEQLAAYSSPALGNDL
FSNYRGQLMQGVQMHCKGERYAQAQNAFQPVASRFTRDLAGRYPFGTLDADDASLDAVKGFFTDYEGRRA
ALQKQVAGINDPYWKSVRQFLAQLDQVDAFLQGNVVPGTAPGDPAADPLLSLNVNFRALKPGANGSNQII
EMNLVSGAKGASFPNGGSTLDWQFGQPLVLDLSWAGLSPWRPSLAVGAPDLQVDGNTASFAAAGNWALLR
MMERHRPSADPATDPRDATRSLLQFDVPVLDSSRAGSPATDTAHVFLGIRLSNVNAKTPTPLKLPAVFPI
SVPPLTPRP
 
Nucleotide Sequence: 4020 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c884159-880140 Burkholderia glumae BGR1 chromosome 2, complete sequence
GTGGACGCAATACTGAAATCGACCGCCTGGCTGAAGGCGCAGACCGGCTGGGCACCCGCTGCCGGCACGC
TGAAGCTGGTGCTGGGCGTGCTGGCCGCCCTGCTCGCGCTGGCCGTGCTGGCGAAGCTGGCCGGCAAGCT
GTGGGCCAGGCTCGGGCCGCTCCTGAAGGCGCCGGCCGTGCCGCCGCTGTGCGGCTGCGAGCCCGCCGCC
GAGACCCGCGCGAAGGGCTGGATCGAACGCGCCTCGCTTGCCCTCGACTATTTGCGCACCGGGCGCGAGT
GGCGCTACGCGACGCCCTGGCTGCTGGTGCTCGGCCAGGCCGGGGCCGGCAAGACCAGCCTGCTCGAATC
GGTCGGCCCGCAGCACACGCAGCCGCTCGGCGAGCGGCAGCAGAGCCTCGCGCTGGAAGGCGCGAGCTGG
CACGCGATCGACCAGAGCCTGGTGCTCGATCCGCTCGGCAAGTGGCCCGAGGCGGCCGCCAGCGCGATGC
TCGACAGCGGCACGGCGGACGGCGCCGATGCGCGCCGCTGGCTGAAGTTCCTCGACCAGCTCGACGCGCT
GCGCCCCGAGCGCGCGCTCGACGGCATCGTGCTGGTGGTGTGCGCCACCACCTTCCTGCAGCGCGACCCG
GCCCGCCTGATGGCCGCCGCGCAGAACGCGCGCCAGCAGCTGCGCACCATCGAGGACCGGCTCGAATTCG
CACTGCCCGTCTATGTCGTGGTCACCGCCTGCGATCACGTCGAGGGCTTCGGCGCGTTCTGGCGCTCGCA
GGCGCCGCAGCGGCACACCGAGATGGTGGGCTGGTCGGCGCCGAGCCAGACCTTCGACACGCCGCCCACC
CAGTGGGGCGCGCAGATCTTCGCGGCGATCGGCGCCCAGCTGCGCGCGCTGCAGGTGGAGACCGCCGCGC
ACTGCGAGCGGATCGCCGCCGACGACGCCGACCCGATGTTCCTCTACCCGCTGCGCTTCGCGCAGTTGCA
GGGGCCGTTCGAGCAGTGGCTGTCGGTGGTGTTCCAGGTATCGGCCTGGGAGACCACCTTCTTCCTGCGC
GGCGTCTATTTCACCGGCCTCGTCGCCGAGCCCGGCGAGCCGCTCGAAGCGCGCGACGGCCCGCGCCGCG
ACGTGGCGTTCGTGCGCGACCTGATGCTCGAGAAGGTGCTCGCGGAGAAGCATCTGGCGCGCCCGACGCG
CGCCGGCGTGTGGTCGCGCAACCTGCTGATCCGCCGCGTGCAGTGGGCCTGCGTGATCGGCTTCTCGCTG
CTGCTGCTGGCGTTCGCCGTGCGGGTGTGGATGATCGACGCGCAGATCGGCCGGGTGATCCAGGCGCTCG
AGCGCATGCAGCAGCTGCAGGCACCCGCGCCCGGCGCCGGCTGCATCGCGCAGGCGCCCGTCTATCAGCT
GATCGAGCAGGTCGCGCAGATCGACGCCGACGCCAGCAGCTGGCTGCTGCCGGCGTCGCTGTTCGATTCG
CGGCTGAGCCACCAGAGCGCGCGGCGCGTGATCGACACCGCGTTGCGCAAGGTGATCCTGCCGGGGCTCG
CGTGCCAGCTGTCGCAACGCGCCTACGCGCTCGGCAACGAGGCCAATCGCGGCATCTCCGCCGGGCTCGG
CTACACCCAGGCGCTCGACCAGCTCCAAGGCTTCGTGCAGCAGGCCGACCAGTACGAGCGCAACGCGGCG
CGCTTCCAGCGCCTGCTGGGCAAGACCCCCTACGCGCGCGAGCGCGTGCCGTTGCCCGGCTTCTTCGATC
TGGTCGAATACGCCTACCGCACGCCGGTGCCGCCGTATCTGCGCGCGCATGCCGGCCTGCTGCCCGTCAC
CCTCGGCGATCTCACCGAGCGCGATTTCAGCGGCGAGATCGCCACCCCGCCGCAGCTCAGGCAGAGCGTC
GGCAATCACATCGTCGCGCTGGCCGCGCAGGCGGGCAGCCTGCTGCAGGCCGAACTGCAATCGGGCCTGC
CGCTGCTCGAACAGCTGCAGGCCAGGCAGCAGCCGATCCTCGCGCACGTCAGGCAGTTCACGCACTGGCT
GAACTGGATCCGCACCGCGTGGCTCGGCTCCAGCGCCGCCGCCAACCCGATCCTGACGGTGCAGAACCAG
CTGCTCGCGAGCCTGCAGCCGCTGGTCGCCGACTTCGGCTATCCGTCCTACATCCAGGCCCAGGTCAGCG
CGCAATTCGACGCCGCGCATCAGTATCCGCTCGCGATGCAGACGCTGAACGCGCTGACGCTGCCCGGCTA
CGGCGCGCTGTTCGTCAACGTCAACGGCCAGATCACGCTGAACCCGGCGATGCAGGGCGAGCTGACCGGC
CTCGACGCGCTCGGCAGCCTCGGCTACATGTCGATCGATCCGCTCGCCAGCTTCAGCTGCACGGGCAAGC
TCGCCAACTGGAGCCAGGGCCTGCTCAAGGACGCCGCCCAGTACCCGGCCGACTACCGGAAGTTCCTGGC
CCAGCCGATGCTCAAGGGCGGCCAGCCCGACGCGCTCTATCGCCAGCTCGCGCGCTACCAGCTCGAACTG
GCGATGAACAACCAGCTCGCGCAGGCGCAGGCCGCGGCCGGCTACGCCGCGAGCGGCACCGACACCAGCA
CCGAGGCGCAGCAGAGCGCCGACAGCGGCAATTTCGCGGCCGTCGCGCCGCTGGTGCTGAACGTGGAGCA
GCAGTTCCGCGCGCTGGGCATGGACGGCAGCGCCACGCAGCTCACGCAGTGCGCGCACCAGTACGCCAAC
AGCCAGCTCGGCCGCATCTCGCTGCTGGCCGACCAGAGCCAGCTGTATCAGCCGGCCTACCTGCCCGCCT
CGCCGGCCCCGGACGCCTACTTCTTCGATCTCGGCAGCACGCCGGTGGTGACCGACATGCTGGCGCGCCA
GGTCAGCCGCGTGCAGGTGCTGGTCGGCTACGCCCAGCCGTTCCTGACCTATCTCGGGCAGGCCGGGCCG
TCGGCCTCGAACGCGAGCGCCAACACCGCCAACGCGGCCTACTGGAACAACACCGCCAGCGAACTCAGGC
GCTACACGCAGGGCAAGGACCCGAACTCGCAGCCGGCCGTGCTCGACAACCTGTTCCTGAAGCTGCTGCC
GGCGCTGCAGAACGACAACTGCGGCGAGCAGCTGGCCGCGTACTCGTCGCCCGCGCTCGGCAACGATCTG
TTCTCGAACTACCGCGGCCAGCTCATGCAGGGCGTGCAGATGCACTGCAAGGGCGAGCGTTACGCGCAGG
CGCAGAACGCGTTCCAGCCGGTGGCGAGCCGCTTCACGCGCGACCTGGCGGGCCGCTATCCGTTCGGCAC
GCTCGACGCCGACGACGCCAGCCTCGACGCCGTGAAGGGCTTCTTCACCGACTACGAGGGCCGGCGCGCC
GCACTGCAGAAGCAGGTGGCGGGCATCAACGATCCGTACTGGAAGAGCGTGCGGCAGTTCCTCGCGCAGC
TCGATCAGGTGGACGCGTTCCTGCAGGGCAACGTGGTGCCGGGCACGGCGCCGGGCGACCCCGCCGCCGA
TCCGCTGCTGAGCCTGAACGTCAACTTCCGCGCCCTCAAGCCCGGCGCGAACGGCAGCAACCAGATCATC
GAGATGAACCTGGTGTCGGGCGCCAAGGGCGCCTCGTTCCCGAACGGCGGCAGCACCCTGGACTGGCAGT
TCGGGCAGCCGCTGGTGCTCGACCTGTCGTGGGCCGGCCTCTCGCCGTGGCGGCCGTCGCTGGCCGTCGG
CGCGCCCGATCTGCAGGTGGACGGCAACACCGCGTCGTTCGCGGCCGCCGGCAACTGGGCGCTGCTGCGT
ATGATGGAGCGCCATCGGCCCAGCGCGGATCCGGCCACCGATCCGCGCGACGCCACGCGCTCGCTGCTGC
AGTTCGACGTGCCGGTGCTCGATTCGAGCCGCGCCGGCAGCCCGGCCACCGATACCGCACACGTATTCCT
CGGTATCCGGCTGTCGAACGTCAACGCGAAAACCCCGACGCCGCTGAAATTGCCGGCGGTATTCCCGATC
TCGGTTCCTCCCTTGACGCCACGACCATGA
 Primer design