SecReT6
Protein ID: 238024495
SecReT6 ID342
T6SS typei2
Gene symbol-
Locus tagbglu_2g10950
StrainBurkholderia glumae BGR1
Repliconchromosome II [GenBank: NC_012721] [Browse all T6SS(s) in this replicon]
Location [Strand]1398818..1402342 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDC5AHW2
KEGG IDbgl:bglu_2g10950
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.30E-75, Aligned region: 256..310
IcmF-related [PF06761], Evalue: 7.30E-75, Aligned region: 414..734
DUF1215 [PF06744], Evalue: 1.40E-34, Aligned region: 248..266
DUF1215 [PF06744], Evalue: 1.40E-34, Aligned region: 869..987
Protein Sequence: 1174 a.a.     [Download]
>gi|238024495|ref|YP_002908727.1| unnamed protein product [Burkholderia glumae BGR1]
MKVSKISGYWVVVIAATIGAAVIAWFKGSAFDPSPVHRIVAVVFIGVLALALRGQLAGGWQAVARHSPGR
LGTRYDRDPIVRVGVTQKEEGENLNAYRGANLCDALRDRHGWRWRYRERWVLVAGDLPLVKRLAPGLVEA
GYLITGDAVLLYAQQTRDTLETDWLDQIRRLRRRRPVDAIVVVTCNRSSANAPFDTDALAQQLARHARAL
RWAAPAYLLNVTDFGSETSSPDEAIGFTWANARISADQIDASLQDLAYNLADAGVVRLAKDAADRYPAEL
SQHISTLHGPLSGLVLQTAQSRIWRQAIHGLLFAPLVEERERAPLLPTDANDDEPAGEPRHRTIWQTVAE
HSRRIHGRRVGFSPSTTAAWITTGLVGCWIAGTMLSGFVNRATIRNVADTIARLSTVQDRTQALQALNGL
DRQIDTLEVHQRDGAPWSTRFGLNRDGALLDALWPGYANAASRILVAPIRQKLEARLRKLASLSDAQIAS
GGNAQVQAVYDTLKAYLMLARPERAVAAFLTPQLVATAAPVRPANSPLSSGAWEDLRQHTIAFLANHLGR
GRWQAMAPDLGLVASTRQTVIGVRGIQNSTDAVYQQILDDAKAKYPPVSLATLLGDTTSRGLFDTTAAVP
GVFTRAAWDERISKAIDKASEQQNVAGDWVLSDVKATQSAPSRLKAQLRQRYFDDYGRAWALFLNSLRWQ
AAPTLSATADQLTLLGDPQRSPLVALMNAIVYQAGAGANAQSLADNLISKAQQLVGGAEKDPSKQTQPPL
APLAKAFGPILRLTGSDLVLGAAASGKAAAPLAATGDLSLARYLERVTAMRLKASQIVSGADPDAMARQA
AQAVLQGRTSDIAESRDYASRLAASLGEQWSGFGELFRAPFDQAWQVVVQPAASSLNDMWRTAIVADWTR
TFGGRYPFADSDNDASLPEMARFMRPDNGVIAQFVTTQLAGVVERQGDRWVAVQGADHGALTIDPGFLAS
LNQLTRVSTMLFPSGDAHLRYELRPEPTPGITDMKFVLSGRELRYFNQKQEWTPFEWPGQSLENLSHIEW
QTEQGGLRTALDSQGRFGLIRLLERAKVSQQDSARYLLTWTPDTSLGLPLRVQLRSEVGSGPLEVLELRH
YTLPARIFVTGATKAEPTPSAIGPPPLPPAAISAAKHAAVPLPDGASGPLPEVE
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|339717964|ref|NC_012721.2|:c1402342-1398818 Burkholderia glumae BGR1 chromosome 2, complete sequence
ATGAAGGTAAGCAAAATCTCCGGCTACTGGGTTGTCGTGATCGCTGCGACGATCGGCGCGGCGGTCATTG
CCTGGTTCAAAGGCTCGGCTTTTGATCCGTCTCCGGTTCATCGGATCGTCGCAGTAGTGTTCATCGGCGT
GCTCGCGCTGGCGCTACGCGGACAGTTGGCAGGTGGGTGGCAGGCCGTAGCCCGACACTCGCCCGGAAGA
TTGGGCACCCGGTACGACCGCGATCCGATCGTCCGAGTTGGCGTCACGCAAAAGGAGGAAGGGGAAAACC
TCAATGCGTACCGCGGCGCGAATCTCTGCGACGCGCTGCGCGACCGCCACGGCTGGCGCTGGCGCTATCG
CGAACGGTGGGTACTCGTCGCCGGTGACCTGCCGCTGGTGAAACGCCTGGCGCCGGGACTCGTCGAGGCC
GGGTATCTGATTACCGGCGACGCGGTCTTGCTGTACGCGCAGCAAACCCGCGACACACTCGAAACGGACT
GGCTCGATCAAATCCGCCGCCTGCGCCGCCGTCGTCCGGTCGACGCGATCGTGGTCGTGACGTGCAATCG
CAGTTCAGCCAATGCTCCGTTCGACACCGACGCGCTTGCCCAACAGCTCGCGCGCCATGCCCGCGCGCTG
CGCTGGGCCGCGCCCGCGTATCTGCTCAACGTCACCGATTTCGGCAGCGAAACGTCGAGTCCCGACGAGG
CGATCGGGTTCACGTGGGCGAACGCGCGCATCAGCGCGGATCAGATCGACGCATCGTTGCAAGACCTCGC
TTACAACCTGGCCGATGCCGGCGTCGTGCGGCTGGCGAAGGATGCCGCCGACCGCTATCCCGCCGAGCTC
TCGCAGCATATTTCGACGCTGCACGGCCCACTGTCCGGGTTGGTGCTGCAGACTGCCCAATCCCGCATCT
GGCGGCAGGCGATTCACGGGCTGCTTTTCGCACCGCTCGTCGAGGAACGGGAGCGGGCACCGTTGTTGCC
CACCGACGCAAACGACGACGAGCCGGCGGGTGAACCTCGACATCGCACGATCTGGCAGACCGTCGCCGAA
CACAGCCGCAGAATCCACGGCCGCCGCGTCGGCTTCTCGCCGTCGACGACAGCGGCCTGGATCACGACCG
GCCTGGTCGGCTGCTGGATCGCCGGCACGATGCTGTCGGGATTCGTCAACCGTGCAACGATCCGGAACGT
GGCCGATACCATTGCGCGGCTGTCGACCGTTCAGGATCGCACGCAGGCCTTGCAAGCGCTCAACGGCCTC
GACCGGCAGATCGATACGCTCGAAGTCCATCAGCGCGACGGCGCGCCGTGGAGCACGCGCTTCGGCCTGA
ACCGCGACGGCGCGCTGCTCGATGCGCTATGGCCGGGCTATGCCAATGCGGCGAGCCGCATCCTCGTGGC
GCCGATCCGCCAGAAGCTCGAGGCGCGCCTGCGCAAGCTTGCCTCCCTGTCGGATGCCCAGATCGCCAGC
GGCGGCAATGCGCAGGTGCAGGCCGTCTACGACACGCTGAAGGCTTACCTGATGCTCGCCAGGCCAGAAC
GGGCGGTCGCCGCATTCCTGACTCCGCAACTCGTCGCGACGGCCGCGCCCGTGCGCCCCGCGAACTCGCC
GCTGTCGTCGGGGGCGTGGGAAGACCTGCGCCAGCACACGATCGCGTTCCTGGCGAATCATCTGGGCCGC
GGAAGGTGGCAGGCGATGGCGCCGGATCTGGGGCTGGTGGCCTCGACGCGCCAGACGGTGATCGGCGTGC
GCGGCATCCAGAACTCGACCGATGCGGTCTATCAGCAGATCCTCGACGACGCGAAGGCCAAGTATCCGCC
TGTCTCGCTCGCGACGCTGCTGGGCGACACGACCAGCCGGGGCCTATTCGATACGACGGCGGCCGTGCCG
GGTGTGTTCACACGCGCCGCCTGGGACGAGCGGATTTCGAAAGCGATCGACAAAGCGAGCGAGCAGCAAA
ACGTGGCGGGCGACTGGGTGCTCTCCGACGTCAAGGCGACGCAGTCCGCACCGTCAAGGCTGAAGGCCCA
GCTGCGCCAGCGCTACTTCGACGATTATGGACGGGCCTGGGCGCTGTTCCTCAACAGCCTGCGCTGGCAA
GCGGCGCCGACGCTGTCCGCCACGGCCGACCAGCTCACGCTGCTGGGCGACCCGCAACGCTCGCCGCTCG
TCGCGCTGATGAACGCGATCGTCTACCAGGCGGGTGCCGGCGCGAATGCGCAGTCGCTCGCCGACAATCT
GATCAGCAAGGCGCAGCAGCTCGTCGGCGGCGCCGAGAAGGATCCGTCGAAGCAGACCCAGCCGCCGCTC
GCGCCGCTTGCCAAGGCGTTCGGGCCGATCCTGCGCCTGACCGGCAGCGATCTGGTGCTAGGCGCAGCTG
CGAGCGGCAAGGCCGCCGCACCGCTTGCCGCGACCGGCGACTTGAGCCTCGCACGATACCTGGAGCGCGT
TACCGCCATGCGCCTGAAGGCCTCGCAGATCGTCTCCGGTGCCGATCCGGACGCGATGGCGCGTCAGGCG
GCGCAGGCGGTCCTGCAAGGCAGGACGTCCGACATCGCCGAGAGCCGCGACTACGCCAGCCGCCTCGCCG
CGAGCCTGGGCGAGCAGTGGTCCGGGTTTGGCGAGCTGTTCCGCGCGCCGTTCGACCAGGCCTGGCAAGT
TGTCGTGCAGCCGGCGGCGTCGAGCCTGAACGACATGTGGCGCACCGCAATCGTGGCGGACTGGACCAGG
ACCTTCGGCGGCCGCTATCCGTTCGCGGACTCCGACAATGACGCGTCGCTGCCCGAAATGGCGCGCTTCA
TGCGGCCCGATAACGGCGTGATCGCGCAGTTCGTCACCACTCAGCTTGCCGGCGTGGTCGAGCGGCAGGG
TGACCGATGGGTGGCGGTGCAGGGGGCCGACCACGGTGCGCTGACGATCGATCCCGGCTTCCTCGCCAGC
CTGAACCAGCTCACCCGTGTCTCGACCATGCTGTTCCCGTCCGGGGACGCGCACCTGCGATACGAGTTGC
GGCCGGAGCCGACGCCGGGCATCACGGACATGAAGTTCGTGCTGTCCGGGCGCGAGCTGCGCTACTTCAA
CCAGAAGCAGGAGTGGACGCCGTTCGAGTGGCCCGGGCAGTCGCTGGAGAACCTGTCGCACATCGAATGG
CAGACCGAGCAGGGCGGGCTGCGCACGGCGCTCGATTCGCAGGGCCGGTTCGGCCTGATCCGGCTGCTGG
AACGTGCGAAAGTCTCGCAGCAGGACAGCGCGCGCTATCTGCTGACCTGGACGCCGGACACGAGCCTCGG
GCTGCCGCTGCGCGTGCAACTGCGCAGCGAGGTCGGCTCGGGGCCGCTGGAGGTGCTGGAACTGCGGCAC
TACACGCTGCCCGCCCGGATCTTCGTCACGGGCGCGACGAAGGCGGAGCCGACGCCGTCGGCCATCGGTC
CGCCACCATTGCCGCCGGCCGCGATCTCGGCGGCCAAACATGCCGCGGTGCCGCTGCCTGATGGCGCATC
GGGTCCATTGCCGGAGGTCGAATGA
 Primer design