SecReT6
Protein ID: 238026071
SecReT6 ID343
T6SS typei4b
Gene symbol-
Locus tagbglu_1g03990
StrainBurkholderia glumae BGR1
Repliconchromosome I [GenBank: NC_012724] [Browse all T6SS(s) in this replicon]
Location [Strand]413562..417437 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC5AA75
KEGG IDbgl:bglu_1g03990
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.40E-71, Aligned region: 191..452
IcmF-related [PF06761], Evalue: 4.70E-54, Aligned region: 496..848
DUF1215 [PF06744], Evalue: 2.70E-29, Aligned region: 981..1096
Protein Sequence: 1291 a.a.     [Download]
>gi|238026071|ref|YP_002910302.1| unnamed protein product [Burkholderia glumae BGR1]
MQRILNVLTHPRTLSILGFIALAAILFIVADALQISFVWPIAILAALVVLWLLVKLVRRLRVKRANRKLG
DMLEEQASVESPAAAAAPVEPAKQAELDTLRTRLVDTVKTIKSSKIGQVSGGSALYELPWYIVIGNPAAG
KSSAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKKHRP
KAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSNSDR
AEYDRVWGATLPYEPDEKRDVVALFDERFEELYDGLKEISVAQLAISRGNILSPGQLSFPLEFASIKPTL
RAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAARFALDGTALPKPPSAFSKNGFFLRDLF
SKVIFEDRKTVRQFASPAKTRMRYATFFAFVAALALALGGWTWSTIGNQQLVANVQADLDNIAKLEQNRN
DLQSRLQAMDILEDRIEQLEQFRHDKPIAVSLGLYQGDRLEEHLLTEYYNGVRQIMLAPVADNLAAFLKD
VNAHPDQLAPMTRAPESGAVPVSDKTALASRAQGGLYNDASPTNVEDAYNALKTYLMLSDKRHVEQAHLT
DQIARFWRGWLETNRGNMPRDEMIRSAERMITFYLSRVQDNDWPMIDANLALIDQTRENLRRVVRGMPAR
QRVYEEIKARASTRYAPMTVARIVGDENASLVAGSYAIPGTFTRDAWFDYVQPAIRDAATKELQAKDWVL
NTASQDDLTLEGSPEQIQKVLVGMYKTEYAQHWQKFMQGIAVQNFGSFGQAVDAMNRLGDPQDSPIRKIL
ETAYEQTSWDNPSLASVTLKKAQTGVVGWVKQWFSRQRGGQLAANIDINGNPVEVPMGPIGQEFIGLARI
VQTHDGGQSMLKGYMESLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGNGSELADSLKYVDELMLTGLTD
SQRRSLRPLLVRPLMQAFAVVIQPASVEVNKVWNAQVYQPFQSSLANKYPFSPGAKVEAAASEIAQVFGP
DGSIAKFVGTTLGPLAVRRGDTLTARTWGDMGLALTPEFTNGFASWVAPLAGGAATSSASSEPQTVFQIL
PQPSSGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPSGSPGATLSATTFDGRTLQLVNEPGRYGLEKLIN
SAQRTRRPDGTFDLTWTQGGVSVSVTMRIISTSQPSGGGSGGDAPQQQSLRGMHLPSSVANTSASGAINA
TAQAPAATSGVSPAAAATGAAANASNAQGAQ
 
Nucleotide Sequence: 3876 bp     [Download]
>gi|339905954|ref|NC_012724.2|:c417437-413562 Burkholderia glumae BGR1 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGTTGACTCACCCGCGCACGCTCTCGATCCTCGGGTTCATCGCGCTCGCCG
CGATCCTGTTCATCGTGGCGGACGCCCTGCAGATCAGCTTCGTCTGGCCGATCGCGATCCTCGCCGCGCT
CGTCGTGCTGTGGCTGCTCGTGAAGCTGGTGCGGCGGCTGCGGGTGAAGCGCGCGAACCGCAAGCTCGGC
GACATGCTCGAGGAACAGGCCTCGGTCGAGAGCCCGGCCGCCGCCGCCGCGCCGGTCGAGCCGGCCAAGC
AGGCCGAGCTGGACACGCTGCGCACGCGCCTCGTCGATACGGTCAAGACCATCAAGAGCTCGAAGATCGG
CCAGGTCTCGGGCGGCTCGGCGCTCTACGAGCTGCCGTGGTACATCGTGATCGGCAACCCGGCGGCGGGC
AAGAGCAGCGCGGTGATCAACTCGGGCCTGCAGTTCCCGTTCGCCGACAAGAACAGCGCCGTGATCCACG
GCATCGGCGGCACCCGCAACTGCGACTGGTTCTTCACCACCGAGGGCATCCTGCTCGACACCGCGGGCCG
CTATTCGGTGCACGAGGAGGACCGCAGCGAATGGCTCGGCTTCCTCGGCCTGCTCAAGAAGCACCGCCCG
AAGGCGCCGATCAACGGCATCATCGTCACGGCCAGCATCGCCGAGCTGACCGGCAACCGCCCCGAATTCG
CCATCAACCTCGCCAAGAACCTGCGCCAGCGCGTGCAGGAGCTGACCGAGAAGCTCGAGGTGTTCGCGCC
GGTCTACGTGATGTTCACCAAGGCCGACCTGATCACCGGCTTCACCGAGTTCTTCAGCAACAGCGACCGC
GCCGAGTACGACCGCGTGTGGGGCGCCACGCTGCCCTACGAGCCCGACGAGAAGCGCGACGTGGTGGCGC
TCTTCGACGAGCGCTTCGAGGAGCTCTACGACGGCCTCAAGGAGATCAGCGTCGCGCAGCTCGCGATCAG
CCGCGGCAACATCCTCTCGCCGGGCCAGCTGAGCTTCCCGCTCGAATTCGCCTCGATCAAGCCCACCCTG
CGCGCGTTCCTCGCCACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCTTCTACT
TCACCAGCGCGCTGCAGGAAGGCGAGACCAACAGCGCCGCCGCGCAGCGCATCGCGGCGCGCTTCGCGCT
CGACGGCACCGCGCTGCCCAAGCCGCCCAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGACCTGTTC
TCGAAGGTGATCTTCGAGGACCGCAAGACGGTGCGCCAGTTCGCGAGCCCCGCCAAGACGCGGATGCGCT
ACGCGACCTTCTTCGCGTTCGTCGCCGCGCTCGCGCTCGCGCTGGGCGGCTGGACCTGGTCGACGATCGG
CAACCAGCAGCTGGTGGCCAACGTGCAGGCCGACCTCGACAACATCGCCAAGCTCGAGCAGAACCGCAAC
GACCTGCAGTCGCGCCTGCAGGCGATGGACATCCTCGAGGACCGCATCGAGCAGCTCGAGCAGTTCCGCC
ACGACAAGCCGATCGCGGTCTCGCTCGGGCTCTACCAGGGCGACCGGCTCGAGGAGCACCTGCTGACCGA
GTACTACAACGGCGTGCGCCAGATCATGCTCGCGCCGGTGGCCGACAACCTCGCCGCGTTCCTGAAGGAC
GTGAACGCGCATCCGGACCAGCTCGCGCCGATGACGCGCGCGCCCGAATCGGGCGCGGTGCCGGTCTCGG
ACAAGACCGCGCTGGCCAGCCGCGCGCAGGGCGGGCTCTACAACGACGCCTCGCCCACCAATGTCGAGGA
CGCCTACAACGCACTGAAGACCTACCTGATGCTGTCCGACAAGCGGCACGTCGAGCAGGCCCACCTGACC
GACCAGATCGCGCGCTTCTGGCGCGGCTGGCTGGAAACCAACCGCGGCAACATGCCTCGTGACGAGATGA
TCCGCAGCGCCGAGCGGATGATCACGTTCTATCTCTCGCGCGTGCAGGACAACGACTGGCCGATGATCGA
CGCGAACCTCGCGCTCATCGACCAGACCCGCGAGAACCTGCGCCGCGTGGTGCGCGGCATGCCGGCCCGC
CAGCGCGTCTACGAGGAAATCAAGGCGCGCGCCTCGACGCGCTACGCGCCGATGACCGTCGCGCGCATCG
TCGGCGACGAGAACGCCTCGCTGGTGGCGGGCAGCTACGCGATCCCCGGCACCTTCACGCGCGACGCCTG
GTTCGACTACGTGCAGCCGGCGATCCGCGACGCGGCCACCAAGGAGCTGCAGGCCAAGGACTGGGTGCTC
AACACCGCCTCGCAGGACGACCTGACGCTGGAAGGCAGCCCCGAGCAGATCCAGAAGGTGCTGGTGGGCA
TGTACAAGACCGAGTACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCGGTGCAGAACTTCGGCAG
CTTCGGGCAGGCCGTCGATGCGATGAACCGGCTCGGCGACCCGCAGGATTCGCCGATCCGCAAGATCCTC
GAGACCGCCTACGAGCAGACCTCGTGGGACAACCCCTCGCTGGCCAGCGTGACGCTGAAGAAGGCGCAGA
CGGGCGTGGTGGGCTGGGTCAAGCAGTGGTTCTCGCGCCAGCGCGGCGGCCAGCTCGCGGCCAACATCGA
CATCAACGGCAATCCGGTGGAGGTGCCGATGGGGCCGATCGGCCAGGAGTTCATCGGGCTCGCCCGGATC
GTGCAGACCCACGACGGCGGCCAGTCGATGCTGAAGGGCTACATGGAGTCGCTCTCGAAGGTGCGCACGC
GCTTCAACGTGATCAAGAACCAGGGCGACCCCGGCCCCGGCGCGCGCCAGCTGATGCAGCAGACGCTCGA
CGGCAACGGCTCCGAGCTGGCCGATTCGCTGAAGTACGTGGACGAGCTGATGCTGACCGGCCTGACCGAC
TCGCAGCGCCGCTCGCTGCGGCCGCTGCTGGTGCGTCCGCTGATGCAGGCGTTCGCGGTGGTGATCCAGC
CGGCCTCGGTGGAAGTCAACAAGGTCTGGAACGCGCAGGTCTACCAGCCGTTCCAGTCGTCGCTGGCCAA
CAAGTATCCGTTCTCGCCGGGCGCCAAGGTCGAGGCCGCCGCCTCCGAGATCGCCCAGGTGTTCGGCCCG
GACGGCTCGATCGCGAAGTTCGTCGGCACCACGCTCGGCCCGCTCGCGGTGCGCCGCGGCGACACGCTGA
CCGCGCGCACCTGGGGCGACATGGGCCTGGCGCTGACGCCGGAGTTCACCAACGGCTTCGCGAGCTGGGT
CGCGCCGCTGGCGGGCGGCGCCGCCACCAGCTCGGCCTCGTCCGAGCCGCAGACGGTGTTCCAGATCCTG
CCGCAGCCGAGCAGCGGCACGACCGAGTACACCATCGCGATCGACGGCCAGCAGCTGCGCTACCGCAACA
CGCCGCCGCAGTGGACCAACTTCGTCTGGCCGAATCCGTCGGGCTCGCCGGGCGCCACGCTGTCGGCGAC
CACCTTCGACGGCCGCACGCTGCAGCTCGTCAACGAGCCGGGCCGCTACGGGCTGGAGAAGCTGATCAAC
TCGGCGCAGCGCACGCGCCGCCCGGACGGCACCTTCGACCTGACGTGGACGCAGGGCGGCGTGAGCGTGT
CGGTGACGATGCGCATCATCAGCACCTCGCAGCCGTCGGGCGGCGGCAGCGGCGGCGACGCCCCGCAGCA
GCAGAGCCTGCGCGGCATGCACCTGCCCTCGTCGGTGGCCAACACCAGCGCGAGCGGCGCCATCAACGCG
ACGGCACAGGCGCCGGCCGCCACGTCCGGCGTGAGCCCGGCCGCGGCCGCCACGGGCGCGGCTGCCAACG
CATCGAACGCACAGGGGGCGCAATGA
 Primer design