SecReT6
Protein ID: 238894427
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2413
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2318423..2321926 [+]
Producthypothetical protein
NoteTssM
UniProt IDC4X7I6
KEGG IDkpu:KP1_2413
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.00E-70, Aligned region: 442..760
DUF1215 [PF06744], Evalue: 1.70E-33, Aligned region: 279..303
DUF1215 [PF06744], Evalue: 1.70E-33, Aligned region: 883..1003
Protein Sequence: 1167 a.a.     [Download]
>gi|238894427|ref|YP_002919161.1| hypothetical protein KP1_2413 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MEHAYYPDSFKTGDGSVKLLLAPKTTEGRYLSVVFILFLLLAAMTFIVWKHPDMAGLEGDSQQQNYWLIG
GCCITGCIFIMLVMLLWTARSAGKKEFEALLDVTRGDDNKRKDESENISVSPAVVMCARIRDHLRTRIGI
HWRRKVRLLLVTGDEAAIEQLVPGLRQQHWLEGNRTVLIYGGSLASEPDREKYIALRKLRRGRPLDGIVR
VMPSSLTLTPQISESDLHGLEKISELLGYAAPVWLWKLCDSEWPQADRAVQAVGVSFPLRATEDDVARQL
AQMLPTLREQGMRQIAEETRHDFLLRLGQQLIDGGIAQWRWQLAPWLTASRQRLALRGLMFSLPEPRTVD
PYQEADTSPVGQPHLLTLPATWLGIVDDCRRLRGHHVGMAWERGLACGLLAILGLWAAGLLLSFALNYSQ
IASVAGKARDLVAHPSVSDYQLTALHALRNEAGRLVHDGQKGAPWYRRFGLDHHQQLLNAVLPWYGVANH
RLIRDPANAALQQALNALVNSAPNSDQRAKLAKPGYDQLKAWLMMARPDKADGAFFAQTMKTVQPTRMGI
STGLWQSLAPDLWAFYLSLLPERPEWKIIPDAQRVSQSRQVLLQQLGRRNAESTLYENMLKSVRRNFADV
SLEDMTSGTDARRLFTTDEVVPGMFTRQAWEGGIQQAIDKAASSRREEIDWVLSDSRKTVSTDLSPEALK
ARLTRRYFTDFAGSWLNFLNSLRLNPATNIADVTDQLTLISDVRQSPLIALMNTLAWQGQAGQQREGLSD
SLIKSAKDLVGGKDKPVIDQSAAGPQGPLDDTFGPLLQLMGKNTGSNVMSADSTLSLQTYLTRITRVRLR
LQQVANASDPQVMMQTLAQTVFQGKSVDLTDTQQYGSLISASLGEEWSGFGNTLFVQPLTQAWETVLLPS
AASLNDKWRRSVVANWHTAFDGRFPFAASKSDASLPMLAEFVRKDSGRIERFLTTELNGVLHKEGSQWVP
DKVNSHGLVFNPAFLRAIDQLSQLSDILFTDGSQGISFELQARPAPEVVETQLTIDGQKLRYFNQMADWQ
TFRWPGETYKPGTLLTWTTVNAGTRLFGDYSGTWGFIRWLEQGKRHPLDRSQWMMSFSAPDGRTLQWVLR
SQLGSGPLALLALRGLTLPDQIFTVDAAESAQALTTGVGNSDMDEME
 
Nucleotide Sequence: 3504 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2318423-2321926 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGAGCACGCTTATTACCCCGATAGCTTCAAGACAGGAGATGGATCTGTGAAGTTACTTTTAGCACCGA
AAACTACGGAAGGTCGCTATCTTTCAGTCGTATTCATTCTCTTTTTACTCTTGGCTGCAATGACATTTAT
CGTCTGGAAACATCCTGACATGGCCGGACTTGAGGGCGATAGTCAGCAGCAGAATTACTGGCTTATTGGT
GGGTGCTGCATTACCGGATGTATCTTTATCATGTTAGTTATGCTCCTGTGGACAGCTCGCAGTGCCGGTA
AAAAGGAGTTTGAGGCGCTCCTGGATGTCACTCGTGGTGATGACAATAAGAGAAAAGATGAGAGTGAAAA
CATCTCTGTTTCTCCAGCAGTGGTGATGTGTGCCAGGATTCGTGACCATCTGCGAACCCGAATTGGAATT
CACTGGCGGCGCAAAGTCCGCCTGCTTTTAGTCACCGGCGACGAGGCGGCAATCGAACAACTGGTGCCTG
GCCTGCGTCAGCAGCACTGGCTTGAAGGCAACCGCACCGTGCTGATTTACGGCGGCAGCCTTGCATCGGA
GCCTGACCGAGAAAAATACATCGCGCTGCGCAAGCTGCGCCGTGGCCGTCCTCTGGACGGAATTGTGCGG
GTGATGCCGTCGTCTCTCACCCTGACGCCGCAGATAAGCGAGAGCGACCTGCACGGGCTGGAAAAAATCA
GCGAACTGCTGGGCTATGCCGCCCCGGTCTGGTTGTGGAAACTATGCGATAGTGAGTGGCCGCAGGCTGA
CCGCGCGGTGCAGGCGGTAGGGGTTAGCTTCCCGTTGCGCGCTACCGAGGACGATGTCGCCCGTCAGCTT
GCGCAGATGCTGCCCACGCTGCGGGAGCAGGGGATGCGCCAGATCGCGGAGGAGACCCGCCACGACTTTC
TGCTGCGTCTGGGACAGCAGCTTATCGACGGGGGGATCGCGCAATGGCGCTGGCAGCTGGCGCCGTGGCT
GACCGCCTCGCGGCAGCGGCTTGCGCTGCGAGGCCTGATGTTTAGCCTGCCAGAGCCTCGTACCGTAGAT
CCGTATCAGGAGGCGGATACCTCGCCTGTGGGCCAGCCTCATCTCCTGACGCTGCCCGCCACCTGGCTGG
GGATCGTCGATGACTGCCGCCGTTTACGCGGGCATCACGTGGGAATGGCGTGGGAGCGGGGCCTGGCGTG
CGGTCTGCTGGCCATCCTCGGCCTGTGGGCGGCGGGACTGCTGCTCTCCTTTGCCCTCAATTACAGTCAG
ATTGCTTCGGTAGCGGGAAAAGCCCGCGACCTGGTGGCCCACCCCTCCGTTTCTGACTATCAACTGACGG
CCCTCCATGCCCTGCGCAATGAGGCCGGCCGTCTCGTGCACGATGGGCAGAAGGGGGCGCCCTGGTATCG
GCGCTTTGGTCTGGACCATCATCAGCAACTATTAAACGCCGTCCTACCCTGGTACGGTGTGGCAAATCAT
CGCCTGATACGTGACCCGGCCAATGCCGCGTTGCAGCAGGCGCTCAACGCGCTGGTCAACTCCGCCCCCA
ATAGCGACCAACGAGCCAAGCTGGCGAAACCGGGCTATGACCAGCTGAAAGCCTGGCTGATGATGGCTCG
TCCGGATAAAGCCGATGGCGCATTTTTTGCGCAGACCATGAAAACGGTCCAGCCGACGCGAATGGGGATC
TCGACCGGTCTGTGGCAAAGTCTGGCGCCGGATTTGTGGGCCTTTTATCTCTCCCTGCTGCCCGAGCGGC
CAGAGTGGAAGATCATCCCGGATGCGCAACGGGTGAGTCAGAGCCGTCAGGTTCTGTTGCAGCAGCTAGG
TCGCCGCAATGCCGAAAGCACCTTATATGAGAACATGCTCAAATCCGTGCGTCGTAATTTTGCCGATGTA
TCGCTGGAAGACATGACCAGTGGCACCGATGCGCGCCGGCTGTTTACCACCGATGAAGTGGTCCCGGGGA
TGTTTACCCGCCAGGCATGGGAAGGCGGCATTCAGCAGGCCATTGATAAGGCAGCCAGCTCGCGCCGGGA
GGAAATCGACTGGGTGCTGAGCGATTCGCGCAAAACGGTGTCGACAGACCTGTCGCCGGAGGCGCTGAAA
GCGCGTCTGACCCGACGCTACTTCACCGATTTCGCCGGCAGCTGGCTGAATTTTCTCAACAGTCTGCGAC
TTAATCCGGCGACCAATATCGCCGATGTTACCGACCAGCTCACGCTGATTAGCGATGTCCGCCAGTCGCC
GCTGATTGCCCTGATGAATACCCTTGCCTGGCAGGGGCAGGCGGGGCAACAAAGGGAGGGGCTGTCGGAC
AGCCTTATTAAATCGGCCAAAGATCTGGTGGGCGGGAAAGACAAGCCGGTCATCGACCAGTCGGCAGCCG
GCCCGCAGGGGCCTCTGGATGACACGTTCGGCCCACTGCTCCAGCTGATGGGGAAAAACACGGGCAGCAA
CGTCATGTCGGCCGATAGCACCCTGAGCCTGCAAACCTATCTGACCCGTATCACCCGCGTGCGCCTGCGC
CTGCAGCAGGTTGCGAATGCTTCCGATCCGCAGGTGATGATGCAGACCCTGGCGCAGACCGTCTTCCAGG
GGAAAAGCGTCGACCTGACCGACACGCAACAGTACGGTAGCCTGATTTCGGCAAGCCTTGGCGAAGAGTG
GAGTGGCTTCGGTAATACTCTGTTTGTGCAGCCGCTGACTCAGGCCTGGGAAACCGTGCTTCTGCCGTCG
GCGGCCAGTCTGAATGATAAATGGCGCCGCTCGGTGGTCGCCAACTGGCACACCGCCTTTGACGGACGCT
TTCCGTTTGCCGCCAGCAAAAGCGACGCCTCCCTGCCGATGCTGGCTGAGTTTGTGCGCAAAGACAGCGG
GCGAATCGAACGTTTTCTCACGACGGAGCTGAACGGTGTCCTGCATAAAGAAGGTAGTCAGTGGGTGCCG
GATAAGGTCAACAGTCACGGCCTGGTCTTTAATCCGGCCTTTCTGCGCGCGATCGACCAGCTAAGCCAGC
TGTCCGACATTCTTTTCACCGACGGCAGCCAGGGGATCAGCTTTGAGTTACAGGCCAGGCCTGCCCCGGA
GGTTGTCGAGACACAGCTGACGATAGACGGCCAAAAGCTGCGCTATTTCAATCAGATGGCCGACTGGCAG
ACTTTCCGCTGGCCGGGGGAGACGTATAAACCCGGCACTCTGCTGACCTGGACCACCGTCAATGCGGGAA
CGCGTCTGTTCGGTGACTACAGCGGTACCTGGGGCTTTATTCGCTGGCTGGAGCAGGGTAAACGCCATCC
GCTGGATCGCAGCCAGTGGATGATGAGCTTCTCCGCTCCGGATGGCCGCACCCTGCAGTGGGTATTGCGC
TCCCAGCTTGGGAGTGGCCCGCTGGCGCTTCTGGCGCTGCGCGGATTGACCCTGCCGGATCAGATTTTCA
CTGTCGATGCGGCTGAGAGCGCACAGGCCCTGACGACGGGGGTAGGGAATAGTGACATGGATGAGATGGA
ATAA
 Primer design