SecReT6
Protein ID: 238895307
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3364
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3190436..3191893 [-]
Producthypothetical protein
NoteTssA
UniProt IDC4XA17
KEGG IDkpu:KP1_3364
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.30E-51, Aligned region: 50..75
DUF3702 [PF12486], Evalue: 3.30E-51, Aligned region: 104..192
DUF3702 [PF12486], Evalue: 3.30E-51, Aligned region: 317..461
ImpA-rel_N [PF06812], Evalue: 1.40E-17, Aligned region: 55..114
ImpA-rel_N [PF06812], Evalue: 1.40E-17, Aligned region: 338..354
ImpA-rel_N [PF06812], Evalue: 1.40E-17, Aligned region: 370..388
Protein Sequence: 485 a.a.     [Download]
>gi|238895307|ref|YP_002920042.1| hypothetical protein KP1_3364 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MTPAPPSNLSLKDIMMTTHHDRHYKAGGDPRTLADFMALRAEMNKLSHPARPDINWPYAEQLARGLLEHH
GADLQTVAWYTLARARLGGVAGINEGLTLMESLLVRQGKNLWPQALPARTEIFRTLSKRLRQVIRTLNLT
PEDVESLEQAERSLQSFDAVLQRLEIAPENQLSDLRALLHSTATRFESLDPAPALPTAPPVAVSDAELPG
TLVSEEDAAKVEPVPDLKRRPKAEPLAPPSPAKRPAPVAASTPAAAPRWKPFIAGMVTMLAVTGIAVGGW
LALRQSDLPPISVTQNAGPIPGLPATTPPGPVDLPQTQRQLGELARLAPDWAVSYGDQLVHQALIRWPDQ
AQPLAQQWRQQLSAGALPAENLTGWSEGMQQLQRLADQLNALDEQKGKYLTVSELKTAVFAITQSFNRAV
PLEEQLRQLAALPVDQPWPAARGSLAELHLQQLIVEYALLKRKQPASPTAALPATGEPSVSEAVK
 
Nucleotide Sequence: 1458 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3191893-3190436 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
TTGACGCCCGCTCCGCCCTCTAATCTCTCGCTGAAAGACATCATGATGACAACACACCACGACCGTCACT
ATAAAGCCGGTGGCGACCCGCGCACGCTGGCTGATTTTATGGCCCTGCGTGCGGAAATGAACAAGCTCAG
CCACCCGGCGCGGCCGGATATTAACTGGCCGTATGCCGAGCAGCTTGCCCGCGGGCTGTTGGAGCATCAC
GGCGCGGACCTGCAGACTGTCGCCTGGTATACCCTGGCCCGCGCCCGGCTGGGCGGGGTGGCAGGGATCA
ATGAGGGGCTGACGCTGATGGAGTCGCTGCTGGTTCGTCAGGGGAAAAACCTGTGGCCACAGGCGCTCCC
GGCCCGGACAGAGATCTTCCGCACCCTGAGCAAGCGGCTGCGGCAGGTGATCCGTACCCTGAATCTTACC
CCAGAGGATGTTGAGTCGCTTGAGCAGGCTGAACGTTCGCTGCAAAGCTTCGACGCAGTACTCCAGCGCC
TTGAGATCGCTCCTGAAAACCAGCTGAGCGACCTGCGGGCGCTACTGCACAGCACGGCAACTCGCTTCGA
GAGCCTCGACCCTGCGCCAGCGCTTCCCACCGCGCCGCCGGTGGCGGTGTCTGACGCGGAACTTCCCGGC
ACTCTGGTCAGCGAAGAGGATGCGGCGAAGGTTGAGCCAGTGCCAGACCTAAAACGTAGACCAAAGGCTG
AGCCGCTGGCTCCGCCTTCACCTGCAAAGCGGCCCGCGCCGGTGGCGGCGTCTACTCCCGCAGCCGCGCC
GCGCTGGAAGCCGTTTATCGCCGGGATGGTTACCATGCTGGCGGTAACGGGTATCGCCGTCGGCGGATGG
CTGGCGCTGCGTCAGTCCGACTTGCCGCCCATTTCGGTCACCCAAAATGCCGGACCGATACCGGGCCTGC
CGGCGACAACGCCCCCGGGGCCGGTTGATCTGCCACAGACGCAGCGCCAGCTTGGCGAGCTTGCCCGCCT
GGCGCCGGACTGGGCGGTCAGCTACGGCGACCAGCTGGTCCACCAGGCCCTGATCCGCTGGCCGGATCAG
GCGCAACCGCTGGCGCAGCAGTGGCGGCAGCAGCTGAGTGCTGGCGCATTGCCCGCGGAAAACCTTACCG
GCTGGTCGGAGGGCATGCAGCAACTGCAGCGGCTCGCCGACCAGCTCAATGCCCTCGACGAGCAGAAGGG
GAAGTACCTGACGGTGAGCGAACTGAAAACCGCAGTATTTGCCATCACGCAGTCGTTTAACCGCGCTGTT
CCGCTGGAGGAGCAGCTGCGCCAGCTGGCCGCGCTTCCCGTTGATCAACCCTGGCCAGCCGCGCGGGGAA
GCCTCGCGGAGCTGCATCTGCAACAGCTGATAGTGGAGTATGCCCTGCTGAAGCGAAAACAGCCGGCGTC
GCCGACCGCTGCGCTCCCCGCAACCGGTGAGCCCTCGGTGAGTGAGGCGGTGAAATAA
 Primer design