SecReT6
Protein ID: 238895308
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3366
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3191871..3192320 [-]
Producthypothetical protein
NoteTssE
UniProt IDC4XA18
KEGG IDkpu:KP1_3366
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.60E-16, Aligned region: 28..115
Protein Sequence: 149 a.a.     [Download]
>gi|238895308|ref|YP_002920043.1| hypothetical protein KP1_3366 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MKMPRPSLYDILYGNFAGGLDLNTVSETDQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTAVLQGMPA
SAHQLMSTLSAVLLKYEPRLQRIAVVMLDQHAPGELRYAIDAELKDIGLVRYGTEFMPEGRVLIRHLKRQ
QYLDARSAL
 
Nucleotide Sequence: 450 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3192320-3191871 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
GTGAAAATGCCTCGTCCCTCCCTGTATGACATCCTGTACGGCAATTTCGCCGGCGGGCTTGACCTGAATA
CTGTCAGCGAAACGGATCAGGTCATCCTGTCGGTGCTCGATAACATGCAGCGCATCCTCAACTGTCGGGC
CGGAACGCTGGCGCATCTGCCGGACTACGGCCTGCCGGATATGACCGCTGTCCTCCAGGGGATGCCAGCG
TCGGCGCACCAGCTGATGAGCACGTTGTCGGCGGTGTTGCTGAAATACGAACCGCGCCTGCAGCGGATCG
CGGTGGTGATGCTCGATCAGCATGCGCCCGGCGAACTGCGCTATGCCATTGATGCGGAGCTGAAGGATAT
TGGCCTGGTGCGTTACGGCACGGAGTTTATGCCCGAGGGCAGGGTGTTGATCCGCCACCTCAAACGTCAG
CAGTACCTTGACGCCCGCTCCGCCCTCTAA
 Primer design