SecReT6
Protein ID: 238895309
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3367
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3192317..3192859 [-]
Producthypothetical protein
NoteTssJ
UniProt IDC4XA19
KEGG IDkpu:KP1_3367
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-38, Aligned region: 21..171
Protein Sequence: 180 a.a.     [Download]
>gi|238895309|ref|YP_002920044.1| hypothetical protein KP1_3367 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MKMAITAVKPSARLLAFLMVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVNNNAKGASL
ATVVRIYQLKDRQAFDNTDYPSLFAGDGQALQADRVAEKDVRLRPGESVTVDMPMETSAQFVAVAAMFID
PDLTQNSWRLVLTRDELDPARPRIIEASQNQLTLHPFKEK
 
Nucleotide Sequence: 543 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3192859-3192317 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAAGATGGCGATTACCGCAGTTAAACCCTCCGCCAGGTTGCTGGCATTCCTCATGGTTACCGTCTTAA
CCGGCTGCGGACTGACGCAGACCGTGAAAGACGGTGCCGTTTCCGTGACCCAGTCCATTTTTTACCCCCA
GGTGAAAACCCTGCATCTGGATCTTCGCGCCCGGGAAGGCGTGAATAACAACGCCAAAGGCGCCTCCCTG
GCGACGGTGGTGCGTATTTATCAGCTGAAGGACCGGCAAGCGTTCGACAATACTGACTACCCGTCGCTGT
TTGCCGGCGATGGCCAGGCGCTGCAGGCGGACCGGGTGGCGGAAAAAGATGTTCGCCTGCGTCCGGGCGA
ATCGGTGACCGTCGATATGCCCATGGAAACCAGCGCGCAGTTTGTGGCGGTGGCGGCCATGTTTATCGAT
CCAGACCTGACGCAAAACAGCTGGCGGCTGGTACTCACCCGGGACGAACTTGATCCGGCGAGGCCGCGCA
TTATCGAAGCCAGCCAAAATCAACTGACGCTGCACCCGTTTAAGGAGAAGTGA
 Primer design