SecReT6
Protein ID: 238895310
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3368
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3192834..3193880 [-]
Producthypothetical protein
NoteTssG
UniProt IDC4XA20
KEGG IDkpu:KP1_3368
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.30E-82, Aligned region: 8..309
Protein Sequence: 348 a.a.     [Download]
>gi|238895310|ref|YP_002920045.1| hypothetical protein KP1_3368 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MAQLRPQLPYMNFYRFCQLLEKNHPKAPIIGSGWLVGDEPIRFRPHPGMGFPAGEIRGMDDPEPPRPPAV
RVTFMGLYGVESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYSYPATFRAGGTDNISQ
YLLGLAGLGIPGCAAVAASPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRATVYHHDPCRIPLSQPL
TMSVRQPVSLQHRPVMGTHATDVNGQVLLQLATEKPDEVRGWLPGGELFSDLMALLHVWLGSHLDVRLQL
CVARHLLPDAQLCCQQEHAVQLGRTAVLRPLDAQKQADDRVTIYLGRYQRVRENIHRRESDEDGDYRS
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3193880-3192834 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGCGCAGCTCCGGCCTCAGTTGCCGTACATGAATTTTTACCGCTTCTGCCAGTTGCTGGAGAAGAACC
ATCCGAAGGCGCCGATCATCGGCAGCGGCTGGCTAGTAGGTGATGAACCCATACGCTTTCGCCCGCATCC
GGGGATGGGCTTTCCGGCTGGTGAAATCCGTGGAATGGACGATCCTGAACCGCCCCGTCCGCCGGCGGTT
CGCGTGACTTTTATGGGACTCTACGGCGTGGAATCCCCGCTGCCGACCCACTATAGCGATGACATTGCGC
AACGGCGGGAAGGCGTCGAGGCCACCGAGGATTTCCTCGATATCTTTAACCATCGGCTGATCGCCCAGTA
TTACCGTATATGGCGCAAATATTCCTACCCGGCAACCTTTCGGGCGGGCGGCACGGACAACATCTCGCAG
TATCTGCTGGGCCTGGCGGGGCTGGGCATACCGGGATGTGCCGCCGTTGCCGCATCGCCGCTGTCGCGAT
TTCTGGCGCTGCTGCCGGTGATGATGCTGCCGGGGAGATCCGGGGAAGGCATGGAGGCGCTGGTGGCGCT
CCTGGCCCCGGGGACCCGGGCGACGGTGTACCACCACGATCCCTGCCGGATCCCCTTGTCGCAGCCGTTA
ACGATGAGCGTCCGTCAGCCGGTTAGCCTGCAACATAGGCCAGTGATGGGAACCCACGCCACGGATGTGA
ACGGTCAGGTATTGCTGCAGCTGGCCACGGAAAAGCCTGATGAGGTTCGCGGCTGGCTGCCCGGCGGCGA
ACTGTTCAGCGACCTGATGGCGCTTCTGCACGTCTGGCTCGGATCTCATCTTGACGTGCGGCTGCAGCTT
TGCGTCGCCCGCCATTTACTGCCGGATGCGCAACTTTGCTGCCAGCAGGAGCATGCCGTCCAGCTCGGCC
GTACCGCTGTGCTGCGTCCTCTGGATGCGCAGAAACAGGCTGACGACAGAGTCACGATTTATCTGGGGCG
CTATCAGCGCGTCCGGGAAAATATCCACCGCAGGGAGAGCGATGAAGATGGCGATTACCGCAGTTAA
 Primer design