SecReT6
Protein ID: 238895311
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3369
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3193880..3195643 [-]
Producthypothetical protein
NoteTssF
UniProt IDC4XA21
KEGG IDkpu:KP1_3369
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-183, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|238895311|ref|YP_002920046.1| hypothetical protein KP1_3369 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKIAETVPAGFEISSRPLGPKNTVCRYRTTRDLTLNPLA
IDEAMMTAEPDGRSALRLRFACSELAGWSQTDLRRLALYLGEDAVTGSALHLWLTRRQAALYLRLPGQTE
RVSLDGYFSPGGFSEEDRLWPKGESAFSGYQLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFS
EVWQSDLPVSASSLRLHCVPVINLFTLEADPLTISGLESEYLLRPKRLQDGHTEIYSVDSVTGSGRTGEA
RYVPFTRFRHQGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQQWEADRELARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCRPTLPAYPPAEDRYHWRVMSHLGTRFLNMMSSAEVLRGTLSLYN
WREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGDVHLFGDMLNRFFALYADMNQ
FNQLTLIVQPEGKCIRWKENHSLRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3195643-3193880 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGACGATTTAACCCTGCGATATTTTGACGCTGAAATGCGCTACCTGCGCGAGGCGGCAAAAGCGTTCG
CGCAGGCTCACCCCGATCGGGCGGCGATGCTGGATCTCGATAAAGCCGGTACGCCGGACCCTTACGTTGA
GCGCCTGTTTGAAGGCTTTGCCTTTTCCGTTGGTCGCTTGCGCGAAAAAATTGATGATGATCTGCCGGAG
CTGACCGAGGGGCTGGTCAGCATGCTGTGGCCGCACTATTTGCGCACCATTCCGTCGTTATCGATCGTGG
CGCTGACCCCAACGCTGCCGGCTATGAAGATAGCGGAAACGGTGCCCGCCGGGTTTGAGATTAGCTCCCG
CCCACTGGGGCCGAAAAATACCGTGTGCCGGTACCGAACCACCCGCGATCTGACGCTTAACCCGCTGGCG
ATAGATGAGGCGATGATGACGGCGGAGCCGGATGGGCGTTCGGCCCTGCGACTACGATTCGCCTGTAGCG
AGCTGGCTGGCTGGTCGCAGACCGATCTCCGCCGCCTGGCGCTGTACCTGGGGGAAGACGCCGTTACCGG
CAGCGCCCTCCATCTGTGGCTGACCCGACGCCAGGCCGCGCTGTACCTGCGTCTGCCGGGTCAGACAGAG
CGGGTAAGCCTCGACGGCTATTTTTCCCCGGGGGGATTCAGCGAGGAGGATCGTTTATGGCCGAAGGGGG
AGAGCGCTTTCAGCGGCTATCAGCTGCTGCTCGAGTATTTCACCTTTCGCGAAAAATTTATGTTCGTGCA
GCTAAATGGCCTGGAAAACATCACCCTGCCGGCGGGGATATCGCATTTCACGCTTGAGGTGGTGTTCAGC
GAGGTCTGGCAAAGTGATTTACCCGTCAGCGCAAGCAGCCTGCGCCTGCACTGTGTGCCGGTGATTAACC
TGTTTACCCTTGAGGCCGATCCGTTGACCATCAGCGGGCTGGAGAGCGAATACCTCCTGCGTCCGAAGCG
CCTGCAGGACGGGCATACCGAAATCTATTCTGTCGACAGCGTGACCGGCTCCGGGCGCACCGGGGAGGCG
CGCTATGTGCCTTTCACCCGCTTTCGTCACCAGGGCGGGATGATGCGTCGCCATGCTCCTGAGCGCTACT
ACCACACCCGCGTAAAACGGGGCGTAACCGGCATGCACGATACCTGGCTTATCCTCGGCGGACAGCAATG
GGAGGCTGACCGGGAGCTGGCGCGGGAAACGGTCTCCTTGCGCATCACCGGCACTAACGGCCAGCTGCCG
CGCCGGGCGCTACAGAGCACGCTGCTGGATCGCTGTGAGTCGATATCAGCCACGCCGCTTACCGTCCGCA
ATCTCTGTAGGCCCACGCTGCCGGCCTATCCCCCGGCGGAAGACCGCTACCACTGGCGGGTCATGAGCCA
TCTGGGCACCCGTTTTCTCAACATGATGAGCAGCGCCGAGGTGCTGCGCGGCACGCTGTCGCTCTACAAC
TGGCGGGAGGATGAGCTCAATAATCGCCGTCTGGACGCCATTCTGGCGGTCAGCCATCACCGAATTCAGC
GTTTCGAGCAGGGCTTCCTGCTGCGCGGGCTGGATATCGAAGTGACGCTCGACGGTAGCGGATTTACCGG
TGCGGGCGATGTCCACCTGTTTGGCGATATGCTCAACCGCTTTTTCGCACTATATGCCGATATGAATCAG
TTCAACCAGCTGACGCTCATTGTTCAACCTGAAGGGAAATGTATCCGGTGGAAAGAGAATCACAGTCTGC
GCCTGCCCGGCTGA
 Primer design