SecReT6
Protein ID: 238895312
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3370
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3195777..3199193 [-]
Producthypothetical protein
NoteTssM
UniProt IDC4XA22
KEGG IDkpu:KP1_3370
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.00E-76, Aligned region: 418..736
DUF1215 [PF06744], Evalue: 2.90E-34, Aligned region: 634..683
DUF1215 [PF06744], Evalue: 2.90E-34, Aligned region: 857..975
Protein Sequence: 1138 a.a.     [Download]
>gi|238895312|ref|YP_002920047.1| hypothetical protein KP1_3370 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MKMNIPGNGLGRFGLAGLTLAGMAAIWWGITRYGGMLNINTRGEQVLAFVQVCLALVFVFYLPAMSRRVK
ESLYRRQSQQDSVLPGEEGRVALTPPHHITVGEIRQTLRYQYGRAWSRKVRILLIIGSVRDVEQLTPKLT
QELWQEDQGTLLLWGGDPGAAVDNAWFTALRKLRYRPADGMVWVTSGFDGVLTTMKRTKPRLTPDEMDSV
SHSLKLRFEALGWKLPLYVWSLYEGGNEKNGRITQPVGCLLPAGCTPQIVAEQFTALASLLIEQGIQQIC
GQPQHNFLLALADQLTRKPETVTEPLSVLLNPYRPQPLAGVVFSEASVEAGRSVRHHWGRDNRWETIPDS
VLWLPAGLRPRKQGVNWMRGMSVAAAALMLLWAASMTVSFIANRHLVAIAQEQVQQASAGKQPLAVRLHA
LSALQKTLSQLEYRSQHGAPWYLRAGLSQNDDLLAALFPRYGERAQPLLRDAAAHHLEEQLTAFVQLPPD
SPLREKMTKTAYGQLKQYLMLTRPEKMDAAWFATTLMQDWPQRSGIADAVWQGSGPSLLAFYAASLASHP
QWRLPVDDGLVSQVRTRLIRQMGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGM
FTRQAWEQAVQPAIEKVVAERRDEMDWVLSDTKQTAAQSTLPEALRARLAERYFADFSGAWLDFLNSLRW
QRAATLSDAIDQLTLMADVRQSPLVALMNTLRVQGRTGQTGEAIADSLVKSARQLFNRDNPPVIDQRSGA
RGPLDATFGPVLALLDNRDGGTPTSRLSLQTFLTRVTQVRLRLQQVTNATDPQAMTRLLAQTVFQGKAVD
LTETRDYGSLVAAGLGQEWSGFGQTLFVRPMEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKN
TSSEVSLPLLAKYLDSETGRIARFLQTRLNGVLHKEGSRWMADSINAQGLTFNPAFLEAMNTLSHLSDVA
FANGEAGLHFALRPGTADGVMQTELVIDSQKLVYMNQMPVWRRFSWPADTEAPGASLSWVSTRAGTRQYG
DFPGAWGWIRLLDKAVVSAYPGTSSSWSLSWKAPDGLLLNYTLRTEAGEGPLALLALRNFTLPETIFSVR
ASAERVPLTDDIPGEEGY
 
Nucleotide Sequence: 3417 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3199193-3195777 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
GTGAAGATGAATATACCGGGTAATGGCCTGGGCCGGTTTGGCCTGGCCGGGCTTACGTTGGCCGGGATGG
CTGCAATATGGTGGGGGATCACCCGCTATGGCGGCATGCTGAATATCAATACGCGGGGCGAGCAGGTACT
GGCGTTTGTCCAGGTCTGTCTGGCGTTGGTATTTGTTTTTTACCTTCCTGCAATGTCCCGCCGTGTGAAG
GAGAGTTTATATCGCCGGCAGTCGCAGCAGGACAGCGTCTTACCCGGCGAAGAAGGGCGCGTGGCGCTGA
CACCTCCCCATCATATTACGGTGGGGGAAATTCGCCAGACTCTACGCTATCAGTATGGACGCGCCTGGTC
CCGCAAAGTCCGTATTCTGCTGATAATTGGCTCAGTCAGAGACGTAGAACAACTGACCCCAAAGCTCACG
CAGGAACTCTGGCAGGAAGATCAGGGTACATTATTGCTGTGGGGTGGAGACCCTGGGGCAGCGGTAGATA
ACGCCTGGTTCACAGCGCTGCGTAAACTGCGTTATCGCCCGGCTGATGGTATGGTGTGGGTAACATCGGG
CTTTGACGGCGTTTTGACAACGATGAAAAGAACGAAGCCCAGGCTCACGCCAGATGAAATGGACAGTGTG
TCTCACTCTCTAAAGCTACGCTTCGAAGCTCTTGGCTGGAAACTACCCCTATACGTCTGGTCGCTGTATG
AGGGGGGCAACGAAAAAAATGGACGTATCACTCAGCCTGTGGGCTGCCTGTTACCTGCAGGTTGTACGCC
GCAAATAGTTGCCGAACAGTTCACTGCCCTGGCGTCGTTACTGATAGAGCAGGGCATCCAGCAGATATGC
GGGCAACCACAGCACAATTTTTTACTCGCGCTGGCCGATCAGTTGACCCGTAAACCGGAAACGGTGACGG
AGCCGTTATCGGTATTGCTTAATCCTTACCGCCCGCAGCCGCTGGCCGGGGTGGTATTTAGTGAGGCGTC
AGTAGAGGCTGGTCGCAGTGTCCGTCATCACTGGGGACGGGATAACCGCTGGGAAACGATACCAGACTCA
GTGCTGTGGTTGCCAGCCGGTCTACGTCCGCGCAAACAGGGAGTCAACTGGATGCGTGGGATGAGCGTGG
CCGCCGCCGCCCTGATGTTACTCTGGGCCGCCTCAATGACAGTCTCTTTTATCGCCAACCGCCACCTGGT
GGCGATCGCACAGGAGCAGGTGCAGCAGGCCTCGGCGGGAAAACAGCCGCTGGCCGTACGCCTGCATGCG
CTCTCCGCGTTACAGAAAACGCTTTCTCAACTGGAATACCGCTCGCAGCACGGAGCGCCGTGGTACCTCC
GCGCAGGCCTCAGTCAGAACGATGACCTGCTGGCGGCGCTGTTCCCGCGCTACGGAGAGAGGGCGCAGCC
GCTGCTGCGCGATGCGGCGGCGCATCATCTGGAAGAGCAGCTCACCGCTTTCGTGCAGCTGCCGCCGGAC
AGCCCACTGCGTGAGAAGATGACGAAGACCGCTTACGGACAACTGAAACAATATCTGATGTTGACCCGCC
CGGAAAAAATGGACGCCGCGTGGTTCGCCACTACGCTAATGCAGGACTGGCCGCAGCGCTCAGGCATCGC
CGACGCCGTCTGGCAGGGCAGCGGCCCTTCGCTGCTGGCATTTTATGCCGCCAGTCTGGCGTCGCATCCG
CAGTGGCGTCTGCCTGTCGATGACGGTCTGGTCAGCCAGGTGCGCACACGGTTAATTCGACAGATGGGCC
AGCGCAACAGTGAGTCCACGCTTTACCAGAAGATGCTCGCGCAGGTGGCGAATCAGTATGCCGATATGCG
CCTGGCGGATATGACTGCCGACACCGATGCTTCGCGTCTGTTCAGCACTGATGAGGTGGTGCCGGGAATG
TTTACCCGTCAGGCCTGGGAGCAGGCCGTGCAGCCGGCCATTGAGAAAGTGGTCGCGGAACGCCGCGATG
AAATGGACTGGGTGCTGAGTGATACGAAGCAGACTGCCGCGCAGTCGACGTTGCCGGAAGCTCTGCGAGC
CAGGCTGGCGGAGCGTTATTTCGCTGATTTTAGCGGCGCCTGGCTGGATTTCCTCAACAGTCTGCGCTGG
CAGCGCGCGGCAACCCTCTCCGATGCTATCGACCAGCTGACCCTGATGGCCGATGTGCGCCAGTCGCCGC
TGGTGGCGCTGATGAACACCCTGCGCGTGCAGGGGCGAACCGGCCAGACCGGGGAAGCCATCGCCGATTC
GCTGGTCAAATCGGCCAGGCAGCTGTTCAACCGTGACAACCCGCCCGTCATCGATCAACGGTCCGGCGCG
CGCGGTCCTCTGGATGCCACCTTCGGGCCCGTACTGGCGCTGCTGGACAATCGCGACGGCGGGACACCCA
CCAGCCGTCTTAGCCTGCAGACCTTCCTGACCCGCGTCACCCAGGTGCGTCTGCGCCTGCAGCAGGTCAC
CAACGCCACCGATCCGCAGGCGATGACCCGGTTGCTTGCGCAGACGGTATTCCAGGGCAAGGCCGTGGAT
TTAACCGAAACGCGCGACTACGGCAGCCTGGTGGCGGCGGGGCTGGGCCAGGAGTGGAGTGGATTTGGGC
AAACGCTGTTTGTTCGCCCAATGGAACAGGCCTGGCAGCAGGTGCTGACCCCGGCGGCGGAAAGCCTCAA
CGCCCAGTGGCGCAGCGCGGTGGTGGAGGACTGGAATAGCGCTTTTGGCGGTCGCTACCCCTTTAAAAAT
ACCAGCAGTGAAGTCTCTCTGCCGCTGCTGGCAAAATACCTCGACAGCGAGACCGGGCGCATCGCCCGCT
TTCTGCAGACCCGGCTGAACGGCGTGCTGCATAAAGAGGGGAGCCGCTGGATGGCGGACAGTATCAATGC
TCAGGGGCTGACGTTTAACCCGGCCTTTCTGGAGGCGATGAATACCCTGAGCCATCTCTCCGACGTCGCG
TTCGCCAACGGCGAAGCGGGATTGCATTTTGCGCTTCGCCCCGGCACGGCGGACGGCGTGATGCAGACGG
AGCTGGTCATCGACAGTCAGAAACTTGTCTATATGAACCAGATGCCGGTCTGGCGGCGGTTCAGCTGGCC
CGCTGACACCGAAGCGCCGGGCGCCAGTCTGAGCTGGGTCAGTACCCGGGCGGGCACCCGCCAGTATGGC
GATTTCCCGGGCGCCTGGGGGTGGATCCGTCTGCTGGATAAGGCGGTGGTCAGCGCTTATCCCGGAACGA
GCAGCAGCTGGAGCCTGAGCTGGAAAGCGCCGGATGGTCTGTTGCTGAACTACACGCTGCGTACCGAGGC
GGGGGAAGGACCGCTGGCGCTGCTGGCGCTGCGAAACTTTACGCTACCGGAGACGATATTCAGCGTGCGC
GCGTCTGCTGAACGTGTTCCGCTGACCGACGATATACCCGGCGAAGAGGGATACTGA
 Primer design