SecReT6
Protein ID: 238895314
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3372
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3200332..3200598 [-]
Producthypothetical protein
NotePAAR
UniProt IDC4XA24
KEGG IDkpu:KP1_3372
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.60E-23, Aligned region: 9..81
Protein Sequence: 88 a.a.     [Download]
>gi|238895314|ref|YP_002920049.1| hypothetical protein KP1_3372 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MSKGFVLLGDKTTHGGAVISASSTMIVNGKPVALVGDKVSCPIPGHGTNAIIEGAPEWSSDGKAIVVDGC
KCQCGCQVISGAPECAIG
 
Nucleotide Sequence: 267 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3200598-3200332 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGTCCAAAGGTTTTGTATTACTCGGCGATAAAACCACGCACGGCGGTGCTGTTATTTCCGCATCCTCCA
CCATGATTGTAAATGGAAAGCCCGTAGCGCTGGTGGGGGATAAAGTCAGCTGCCCGATTCCGGGACATGG
CACTAATGCCATTATTGAGGGAGCGCCGGAATGGTCTTCCGATGGTAAAGCCATCGTGGTCGATGGCTGC
AAATGTCAGTGCGGTTGCCAGGTGATTTCCGGCGCGCCGGAATGCGCGATAGGATAA
 Primer design