SecReT6
Protein ID: 238895326
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3385
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3211181..3212878 [-]
Producthypothetical protein
NoteTagL
UniProt IDC4XA36, C4XA36
KEGG IDkpu:KP1_3385
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.40E-17, Aligned region: 435..531
DUF4381 [PF14316], Evalue: 0.0062, Aligned region: 23..61
Protein Sequence: 565 a.a.     [Download]
>gi|238895326|ref|YP_002920061.1| hypothetical protein KP1_3385 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MRDNARRLLTILTVILALWLVLGFWPLSIGNQVIFSLCILLAGGAALWRQRRRAVSRQRSEIVLPPEDFQ
GAVVLVCGDTDGLFPGRSAHGETRHGWYLRGDSAEQLPGLAQYLAAARPALVSQVSVLLAVVPEHHPSGE
HLAQSLRDWRRSIVQCRTWLNGLPPVWSVFWVTPPGGQAGESRWFTITPERPGLQVQQKGQAPQAVAGWQ
REGSPASRLHQTLWLESILTLAENALFRPFRARQAELPPLNLCAAGICLTPVAAVANNLWQQQIAAITTL
SPGNDAAPGPHPLPDLLLSSLPHRHGVSRRMRDAGLSAGVGFLFLALAMLASFINNQRLVRSVGDHLAVY
HRLSGTPPTPKLQAQQRLRADSRLLDDWLRRGEPLRYRLGLYQGGRLIPFVEAAINDWAPPPPPRPVIKQ
VVQGPQTIRLDSMALFDTGKSALKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDRSNQQLSLKRAE
AVRDWMRDTGDVPESCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKDACLTPGTANTSGVETNGL
KSETE
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3212878-3211181 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGCGTGATAACGCTCGTCGTCTGCTTACGATACTGACCGTCATCCTGGCCCTGTGGCTAGTGCTGGGCT
TCTGGCCGCTGTCCATCGGCAACCAGGTGATCTTCAGTCTGTGCATCCTGCTGGCGGGCGGCGCGGCGCT
CTGGCGTCAGCGTCGCCGGGCAGTCAGCCGTCAGCGATCGGAAATCGTCCTGCCGCCCGAGGATTTTCAG
GGGGCAGTGGTTCTGGTCTGCGGGGATACCGACGGTCTGTTTCCCGGGCGTTCGGCGCACGGCGAAACCC
GTCACGGCTGGTATCTACGGGGAGACAGCGCGGAGCAATTGCCGGGGCTGGCGCAGTACCTGGCGGCGGC
GCGTCCGGCACTGGTATCGCAGGTTTCCGTGCTGCTGGCGGTGGTACCGGAGCACCACCCCTCCGGGGAG
CATCTGGCGCAGTCGCTGCGCGACTGGCGGCGGAGTATCGTTCAGTGCCGAACCTGGCTAAACGGTCTGC
CGCCGGTGTGGAGCGTGTTCTGGGTGACGCCGCCAGGCGGCCAGGCAGGGGAAAGCCGCTGGTTTACCAT
CACGCCGGAGAGGCCTGGGCTCCAGGTGCAGCAGAAGGGACAAGCGCCCCAGGCGGTTGCCGGGTGGCAG
CGGGAGGGCAGCCCTGCCTCACGCCTGCATCAGACGCTGTGGCTGGAGAGCATTCTGACCTTGGCCGAAA
ACGCTCTTTTCCGGCCATTCCGCGCCCGGCAGGCGGAACTTCCTCCGCTGAACCTGTGTGCCGCGGGCAT
CTGCCTGACACCGGTAGCGGCGGTGGCGAATAACCTCTGGCAACAGCAAATCGCCGCGATCACCACGCTC
TCCCCGGGCAACGACGCGGCGCCAGGTCCTCACCCGCTGCCGGATCTTCTTCTGTCGTCACTGCCGCACC
GCCACGGGGTCAGCCGCCGGATGCGCGATGCCGGTCTTTCCGCTGGGGTGGGCTTCCTCTTTCTGGCGCT
GGCGATGCTGGCTTCCTTTATCAACAACCAGCGCCTGGTGCGCAGCGTCGGCGATCATCTGGCGGTGTAC
CACCGCCTCAGCGGCACGCCGCCGACGCCGAAGCTGCAGGCGCAGCAGCGTCTGCGTGCCGACAGCCGCC
TGCTGGATGACTGGTTGCGCCGGGGGGAGCCGCTGCGTTATCGGCTGGGGCTGTATCAGGGGGGGCGGCT
GATCCCCTTCGTGGAAGCCGCTATCAATGACTGGGCGCCGCCCCCGCCGCCGCGTCCGGTCATTAAGCAG
GTTGTGCAGGGGCCGCAGACGATCCGCCTCGATAGCATGGCGCTGTTCGATACCGGCAAATCGGCGCTGA
AACCGGGTTCGACAAAGCTGCTGGTGAACTCGCTGCTGGGCATTAAGGCCAAACCCGGCTGGCTGATCGT
GGTGGCAGGCCATACCGACAGCATCGGCAACGATAGATCCAATCAACAACTCTCCCTGAAGCGTGCCGAG
GCGGTCCGCGACTGGATGCGCGATACCGGCGATGTGCCGGAGAGCTGTTTTGCGGTGCAGGGCTACGGCG
CAAGCCGTCCTGTCGCCAGCAACGAGACGCCAGAGGGGCGGGCGCAAAATCGCCGGGTGGAGATCAGTCT
GGTCCCGCAGAAGGACGCCTGTCTGACGCCGGGCACGGCCAATACCTCAGGAGTAGAGACTAACGGATTA
AAAAGCGAAACCGAGTAA
 Primer design