SecReT6
Protein ID: 238895327
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3386
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3212882..3213535 [-]
Producthypothetical protein
NoteTssL
UniProt IDC4XA37
KEGG IDkpu:KP1_3386
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-41, Aligned region: 10..205
Protein Sequence: 217 a.a.     [Download]
>gi|238895327|ref|YP_002920062.1| hypothetical protein KP1_3386 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MNTSESDLINKTFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAGGVSEASAEQMLYAYCAL
LDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTADAAVLTCFFRTLQLGFVGQY
RAEDDERREDVAQALGARVPPFSLTQEAPVVVRASRLRSGRRMYWCGWAAGIVALAALWLTCSAMLSQMV
AQIAGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3213535-3212882 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAATACCTCTGAAAGCGATCTGATCAACAAAACTTTTTACCCGGGCTGGCTGATGGTCAGCCAGTTAC
GCTGCGGCCAGCCGGTGACGGATGGCGAGGCGCTCTATCGCCAGGCCTGTCGATGGGTGACCGAGGCGCG
CGAGGCGCTGACGGCGGGGGGAGTCAGTGAAGCCAGCGCTGAGCAGATGCTCTATGCCTACTGCGCGCTG
CTGGATGAGAGCGTCCTCAACCGCGCCAGTCAGGATGATGGCTACCGCAGGTGGCGCAAGGATCCGCTGC
AGGCGCGCTTTTTCAGCACTCTCAACGCCGGGGAAGAGCTCTGGGAACGGATCCGCCAGCTGCTGCGAGA
GCCCACGGCGGATGCGGCAGTGCTGACCTGCTTCTTTCGTACTTTACAGCTGGGATTTGTCGGACAGTAC
CGCGCCGAGGATGACGAACGGCGTGAGGACGTGGCGCAAGCGCTTGGCGCGCGGGTCCCGCCGTTCAGCC
TGACCCAGGAGGCGCCGGTGGTGGTTCGTGCCTCCCGGCTGCGCAGCGGACGGCGGATGTACTGGTGCGG
CTGGGCGGCTGGCATTGTGGCGCTGGCGGCGCTGTGGTTGACCTGCTCCGCCATGCTGTCACAGATGGTG
GCGCAGATAGCAGGGCAGGGATAA
 Primer design