SecReT6
Protein ID: 238895328
SecReT6 ID345
T6SS typeN/A
Gene symbol-
Locus tagKP1_3387
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]3213532..3214872 [-]
Producthypothetical protein
NoteTssK
UniProt IDC4XA38
KEGG IDkpu:KP1_3387
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.70E-131, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|238895328|ref|YP_002920063.1| hypothetical protein KP1_3387 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDASALTLSRLNATRLIVRFAD
GTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGNLDDGQESARPRRWRAEQVTVQELAGHERS
ELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELGELLHRLQAR
RRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHQDPSRHPELLYRELARLAGSLLTFSLE
HHLEAIPRYRHASPEQVFPPLFALLDTLLEVSLPSRVIAIALEQGADREIWRGRLHDARLREGADFYLSV
RSSLPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALDLSTDAARAML
EAGNCTFYTPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c3214872-3213532 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAAGATTTTCCGCCCATTATGGCGCGACGGGGCTTTTCTGGTCCCGCAGCAGTTTCAGCAACAGGCCC
GCTGGGACGCGCACGTCGCCGATACGGTCTCCCGCATGGCTCTCGCCCACCCGTGGGGGGTATTGCGCGC
GGAGTTTGACGCGAGCGCGCTCACCCTTTCCCGGCTCAACGCTACCCGGCTGATCGTGCGTTTCGCCGAC
GGAACGCTGATTGACACCGAGCTGGCGGATATTTTGCCACCGGTCCGCGATGTATCGGACGTGATGCAGG
ACAGCGTGGAGGTTCTGCTCGCTCTGCCGCTGCTCAGCGCCAGCGGCGGCAATCTTGATGACGGCCAGGA
GAGCGCCCGCCCGCGCCGCTGGCGCGCCGAGCAGGTGACCGTCCAGGAGCTGGCCGGCCATGAACGCAGC
GAGCTGGCCGTTCTGCGGCACGCGCTAACGCTGCGTCTCTCCACCGAGGAAAATGCAGCCTTTCTCACCT
GCCCGGTAGCGCGTCTGGTGCGCGACGCCCAGGGGCAGTGGATCGTTGACCCGGAATTCATCCCGCCGCT
GCTGTCGCTGGCGGCAAGCCCGACGCTGGTCAGCGAGCTGGGCGAGCTGTTACATCGCCTGCAGGCCCGA
CGCAGACGCCTGATGGCCATGCGTCGTGAAAGCAATGCGCGGATGGCTGATTTTGCCGTGGCGGATGTTT
CCCTGTTCTGGCTGCTCAACGCGCTGAACAGCGCTGAACCGGTGCTCAGCGAGCTGCATCAGGACCCTTC
GCGCCATCCGGAGCTGCTCTATCGCGAACTGGCCAGGCTGGCCGGCAGTCTGCTGACTTTCTCCCTTGAA
CATCATCTGGAAGCAATCCCCCGCTACCGGCATGCCTCGCCAGAGCAGGTATTCCCGCCGCTGTTTGCCC
TGCTGGATACGCTGCTCGAAGTCAGCCTGCCCTCAAGGGTGATCGCCATCGCTCTGGAGCAGGGCGCCGA
CCGGGAGATCTGGCGGGGCAGGCTGCACGATGCGCGGCTGCGCGAGGGGGCGGATTTTTATCTGTCGGTG
CGCTCTTCACTCCCCCCTCACCAGCTACAGAGCCGCTTTCCGCAGCTCTGTAAGGCGGGTAGCCATGATG
ATGTCGCCGAGGTCGTCAATATTGCCCTCAGCGGCATCGCGATCAAACCGCTGAGCCATGTGCCGGCGGC
CATTCCGCTACGTCTGGAAAACCAATATTTCGCTCTGGATCTCTCCACCGACGCCGCCCGCGCGATGCTG
GAGGCCGGCAACTGCACCTTCTATACCCCGGAATCGCTTGGCGACGTGAAACTTGAACTCTTTGCGGTAC
TGCGCTCATGA
 Primer design