SecReT6
Protein ID: 238920639
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2751
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2647948..2651730 [+]
Producthypothetical protein
NoteTssM
UniProt IDC5BAE9
KEGG IDeic:NT01EI_2751
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.00E-50, Aligned region: 170..423
ImcF-related_N [PF14331], Evalue: 4.00E-50, Aligned region: 893..929
ImcF-related_N [PF14331], Evalue: 4.00E-50, Aligned region: 1008..1037
DUF1215 [PF06744], Evalue: 5.00E-05, Aligned region: 938..988
DUF1215 [PF06744], Evalue: 5.00E-05, Aligned region: 998..1022
Protein Sequence: 1260 a.a.     [Download]
>gi|238920639|ref|YP_002934154.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MKRIFKWIAIALILIMLAMLCWLLTFWQRWPAAAAWVLFLAILAGALLTRYIWRKVRAWRTRSLEAEPVK
KNSATERHPVTLQRQWRAATTLLRHSQLRRFRHPLQVLPWFMMLGRPGSGKSALLTQSGLAAPLDLPHEM
HDGKAPVGWWYFDKAVILDISGQFVQPEASQDTRTTWNRMLDLLGRDRAQAGLSGLVLTVSAQTLLSANG
EDLIDEGRLIRTRIEQLIRLFDRRFPVYVLVTQIDSLYGMEAWSHLLPQEVQEQAMGHIVDEPEIGHDVR
DVIDIVLSKVNSRLKTMQLAMILRHPDADPALLMFPTELARLAEPLKRYVQHALGDSPYLESPILRGAFF
TSAVQEGNTRSGSRDQQEIALQEAAHDTVKQGIFVRDLFNRVLPADRDLSRPVAVTSPWRRLNRHLGLFA
WWLCVAAALGYLGVSAVYWQRTLDDLRQRYPETMIMNNTLPHDMRIMIAQRDAIYWLEKRNAQWASRVLA
FQHQLQYVEADAKSQYVNDFSKYILPSLDKAIRQSTTEENITSHPDGLVNAFQIEARRANLLRARLRGSS
YGALMAMPPIPTPSLQLLYPTLDSNTVSRFNDLFLSQLAWSSDLQLQNSRLLHLQDRLRQLAAQSATLDW
VIPWANAQPDLASVTLTDFWQGSLRPNKLPEVAAAYTLNGERRIHSFLSEIRNSMPNDSAFDKKLTVFRQ
EYAQKRLQAWQDFVGQFSQGEQILAGQGEWQSTIGRLPHDDNPYLRLARRLLSEFADMPDDLRPGWLRVL
PQWLEVRQRAHQQAIVRVPGLVSDMGSMILRGAAQKGGLDQPRSQLVSRLDAIRLYQEYQAAITQAMNSV
VTSQAQATKVAADFHGFDSQQNGQSPLQTAYARLISLRSLLGHNRPDEQLTWGLMAGSLQLVIRYADQQA
SCFLQNAWQDNVIAPSRWTLNQADRADKLYGENGVIWTFLSGPIKPFIQRNDSGWQVVDTLGQSVPFTAD
FLPFINQALIRQVDLKAGKIEQHQKQQLATLAQQQQKQQWQTLAAESAEKLAELNTTANTLKANSYPVSL
MGLPTDVNSDARAKVVGTLLTMQCSNATLRLNNLNFAVMQSIQWSQHQCGQVTLQIRLPAFTLTRSYPGP
RGFVNFLRDFPGGARRFTPADFPADKNRMAAVGITHITVRYRISGQETLLQDAAQLIQTESDIQSAQSRQ
QQAQQALITLNQPTAPEIPPAVDQLPVLNVMGVPERIGQCWRGDVRLARENGSIGQLMSELVAKQLTDKP
 
Nucleotide Sequence: 3783 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2647948-2651730 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAAACGTATCTTCAAATGGATAGCGATTGCACTGATTCTGATCATGCTGGCGATGCTGTGCTGGCTGC
TCACGTTTTGGCAACGCTGGCCTGCCGCTGCCGCATGGGTACTGTTTCTCGCCATTCTGGCCGGCGCCCT
GCTGACACGCTATATCTGGCGTAAGGTACGGGCATGGCGTACCCGCAGCCTGGAGGCGGAGCCGGTTAAA
AAAAACAGCGCCACGGAACGCCATCCCGTAACGCTACAGCGCCAGTGGAGAGCGGCCACAACCCTGTTGA
GGCACTCCCAGCTGCGCCGTTTCCGCCACCCGCTGCAAGTCCTACCCTGGTTTATGATGCTGGGCCGTCC
AGGCTCAGGTAAATCGGCGCTGCTGACACAGTCAGGCCTGGCCGCACCGTTGGATTTGCCCCATGAGATG
CATGACGGTAAGGCGCCTGTCGGCTGGTGGTATTTCGACAAGGCCGTCATCCTGGATATCTCCGGCCAGT
TTGTACAGCCGGAGGCATCGCAGGATACCCGTACGACCTGGAACAGAATGCTGGATCTGCTGGGGCGCGA
TCGCGCCCAGGCCGGCTTGAGTGGGCTGGTGCTCACGGTGTCGGCCCAGACCCTGCTGTCAGCGAATGGT
GAAGACCTGATCGATGAGGGGCGGCTAATCCGAACCCGGATAGAGCAACTGATCCGTCTGTTCGACAGAC
GCTTCCCCGTCTACGTACTGGTAACCCAAATTGACAGCCTGTACGGCATGGAGGCCTGGTCCCACCTGCT
GCCCCAAGAGGTACAGGAACAGGCCATGGGTCACATTGTGGACGAACCGGAGATCGGTCACGATGTCCGT
GATGTGATCGATATCGTATTGAGCAAGGTAAATAGCCGACTGAAAACCATGCAGCTGGCGATGATACTGC
GGCACCCGGATGCCGATCCGGCCCTATTGATGTTCCCTACCGAGCTGGCCAGACTGGCCGAGCCTCTCAA
GCGCTATGTCCAGCATGCCCTGGGAGACAGCCCCTATCTGGAGTCACCCATACTGCGTGGCGCCTTTTTC
ACCAGTGCGGTTCAGGAGGGGAACACCCGCAGCGGGTCCCGGGATCAGCAGGAGATTGCGCTGCAAGAGG
CGGCACATGATACCGTCAAACAAGGGATCTTTGTCCGGGATCTGTTCAACCGCGTTCTGCCGGCAGACCG
TGACCTGAGCCGCCCTGTTGCCGTGACCAGTCCCTGGCGGCGTCTGAACCGTCATCTGGGCCTGTTTGCC
TGGTGGCTGTGTGTAGCCGCAGCCCTTGGGTATCTCGGCGTATCGGCCGTATACTGGCAGCGTACGCTGG
ATGATCTGCGCCAGCGCTATCCGGAGACCATGATCATGAATAACACCCTGCCCCACGATATGCGGATTAT
GATTGCACAGCGGGATGCGATTTATTGGCTGGAAAAGAGAAACGCGCAGTGGGCCAGCCGGGTACTGGCA
TTCCAGCATCAGCTTCAATATGTTGAAGCTGATGCAAAATCACAGTATGTAAATGATTTTAGCAAATATA
TATTGCCCAGCCTGGATAAAGCCATTCGCCAGAGTACCACGGAGGAAAACATCACATCCCATCCGGACGG
ACTGGTGAATGCCTTTCAGATCGAAGCCCGCCGCGCGAACCTACTACGGGCGAGGCTGCGGGGCTCCAGC
TATGGAGCGTTGATGGCCATGCCCCCCATACCGACCCCGTCCCTACAGTTACTCTATCCGACCCTGGATT
CGAATACGGTATCCCGTTTCAATGACCTGTTCCTGTCCCAACTTGCCTGGTCATCGGATCTCCAGCTGCA
AAATTCCCGTCTGCTGCACCTGCAAGACAGGCTCCGACAGCTGGCGGCACAAAGTGCCACCCTGGACTGG
GTCATTCCATGGGCAAACGCCCAGCCTGATTTGGCAAGCGTAACCCTGACCGACTTCTGGCAGGGCTCAC
TGCGGCCGAATAAACTGCCGGAGGTCGCTGCGGCCTATACCCTGAATGGAGAGCGGCGTATCCACTCATT
CCTGAGTGAGATACGCAACAGCATGCCGAACGACTCCGCCTTCGACAAAAAGCTGACCGTATTCAGGCAG
GAATATGCGCAGAAACGATTGCAGGCCTGGCAGGATTTCGTCGGCCAGTTTTCTCAGGGAGAGCAGATCC
TGGCCGGTCAGGGCGAGTGGCAGAGTACCATTGGCAGACTGCCCCATGATGACAACCCGTATCTGCGCCT
TGCCCGCCGTCTGTTGAGCGAATTCGCCGACATGCCGGATGACTTGCGCCCGGGCTGGCTCCGTGTGCTC
CCGCAGTGGCTGGAGGTACGCCAGCGCGCCCACCAGCAGGCCATCGTCAGGGTTCCCGGGCTGGTCAGTG
ATATGGGCAGCATGATCCTGCGCGGGGCGGCGCAGAAGGGGGGACTGGATCAGCCCCGCAGCCAGCTCGT
CAGCCGACTCGATGCCATTCGCCTGTATCAGGAGTATCAGGCGGCCATAACCCAGGCAATGAACAGCGTC
GTCACCAGTCAGGCTCAGGCCACCAAAGTGGCGGCGGACTTCCATGGCTTTGACAGCCAGCAGAACGGAC
AGTCCCCATTGCAGACGGCCTATGCACGCCTGATAAGTCTACGCAGCCTGCTGGGACACAATCGGCCGGA
CGAACAGCTCACCTGGGGGCTGATGGCTGGCTCCTTACAGCTGGTTATACGCTATGCCGATCAGCAAGCC
TCCTGTTTCCTGCAGAACGCGTGGCAGGACAACGTCATCGCACCATCGCGCTGGACCCTTAATCAGGCCG
ATCGGGCGGATAAGCTGTATGGTGAGAATGGAGTGATCTGGACCTTTTTGTCCGGTCCAATTAAGCCGTT
TATCCAGCGTAACGATTCGGGCTGGCAGGTGGTGGATACCCTGGGACAATCAGTCCCCTTTACCGCAGAC
TTCCTGCCGTTTATCAATCAGGCCCTGATTCGCCAGGTTGATCTGAAAGCTGGAAAAATCGAACAGCATC
AGAAACAGCAGCTGGCCACCCTGGCCCAGCAGCAGCAGAAGCAACAGTGGCAAACCCTTGCCGCAGAGTC
TGCCGAAAAACTGGCCGAACTGAACACCACCGCCAATACCCTGAAAGCGAATAGCTATCCCGTCTCCCTG
ATGGGACTGCCCACGGACGTCAACAGCGATGCCAGGGCCAAGGTCGTAGGAACCCTGTTGACCATGCAGT
GCTCCAATGCCACGCTCCGGCTAAACAACCTTAACTTTGCCGTAATGCAAAGTATACAGTGGTCACAGCA
TCAGTGCGGCCAGGTGACGCTGCAGATCAGGCTCCCTGCCTTTACGCTGACGCGCAGCTATCCCGGGCCT
AGGGGCTTTGTCAACTTCTTACGGGATTTCCCGGGCGGAGCACGCCGTTTTACCCCGGCGGACTTCCCCG
CTGACAAAAACCGGATGGCAGCGGTCGGGATAACCCATATTACGGTACGCTACCGTATCTCTGGGCAGGA
GACCCTGTTGCAAGACGCCGCTCAGCTGATACAGACAGAAAGTGATATTCAGTCAGCCCAGAGTCGCCAG
CAGCAGGCACAGCAAGCCCTGATCACATTGAATCAGCCGACCGCACCGGAGATCCCTCCGGCTGTGGATC
AGCTGCCGGTGCTGAATGTGATGGGTGTACCGGAGCGCATCGGACAGTGCTGGCGGGGGGATGTTCGCCT
TGCCAGAGAAAACGGCAGCATTGGTCAGTTAATGAGTGAGTTGGTCGCCAAACAGTTAACCGACAAGCCC
TAA
 Primer design