SecReT6
Protein ID: 239509140
SecReT6 ID802
T6SS typeN/A
Gene symbolvtsI
Locus tagvtsI
StrainVibrio anguillarum NB10
Repliconchromosome [GenBank: GQ118992] [Browse all T6SS(s) in this replicon]
Location [Strand]9837..11619 [+]
ProductVtsI
NoteTssM
UniProt IDC5MK47
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.40E-49, Aligned region: 166..421
IcmF-related [PF06761], Evalue: 4.60E-15, Aligned region: 343..389
IcmF-related [PF06761], Evalue: 4.60E-15, Aligned region: 473..578
DUF4381 [PF14316], Evalue: 8.20E-06, Aligned region: 32..131
DUF4381 [PF14316], Evalue: 8.20E-06, Aligned region: 417..475
DUF4131 [PF13567], Evalue: 0.0025, Aligned region: 8..73
Protein Sequence: 593.3333333 a.a.     [Download]
>gi|239509140|ref|ACR81563.1| VtsI [Vibrio anguillarum]
MFKKIFSIFLVITAILGTLAFWLTASEEQPVWIKWGMLAVTVVIVFFTCVWWWKQRKLNQTEKEEHDQHV
LLKQDTRVIQQLFRIATKKIQGQARNKLESLYSLPWYLVLGGEKDAKSAILLQNGFEPVNERYLDESDTE
QYLRFWSNDNAVVVEVGHRIFDNDGIDESLWQVLAKQLLKYRPRQGLNGIVTVIGCDRLMTGDKKERTRL
SGIYQEAVLSMGAELSLNLPVYAAFSKADSIADFTGFFESFTACDSENPFGITFECDVSRRYDKQQFEAE
SHALIQSIAGQQFELLRNVSSDKSGSIIAWPYQLRIFLERVNEFLSDIGRENRVREAVWIRGAYLMSSGQ
KGIEHDLLTQVVAERAEFNTNNQVEQQPNRRGFFTQRLFNKVILPEKNIVGVNEWRHAGYLVFRTAVLVS
VVGLISIAGLKLQENWNVDEDWRTTALSQIRFYQNDVQKLSNDNSMSEVVAVLRELGDVVAEGVQPKPWH
EKVSIKQTDTAESVYSAYEKQLHQIMLPKLEELISSELYVYVNLGNPSRIFEILRYYQMLFDREQLNFAE
LQTYLLDNLKDQGELSPDELYSFSLLIEDLFKSQ
 
Nucleotide Sequence: 1783 bp     [Download]
>gi|239509130|gb|GQ118992|vtsI|:9837-11619
ATGTTTAAAAAGATATTTTCTATTTTCTTGGTGATTACTGCCATTTTAGGGACGCTCGCATTTTGGCTTA
CAGCATCAGAAGAGCAACCAGTCTGGATAAAGTGGGGAATGCTCGCTGTCACCGTCGTTATTGTCTTCTT
TACATGTGTTTGGTGGTGGAAACAGCGCAAGCTTAATCAAACAGAGAAAGAAGAGCATGATCAACACGTA
CTGCTTAAACAAGACACGCGTGTGATCCAGCAGCTGTTTCGTATCGCAACGAAAAAGATACAGGGACAAG
CTCGTAACAAGCTAGAAAGCCTTTACAGTCTGCCTTGGTACCTAGTTCTAGGTGGTGAAAAAGACGCGAA
AAGTGCCATTTTGCTACAGAATGGTTTTGAGCCAGTTAACGAGCGCTACTTGGATGAAAGTGATACGGAA
CAGTACCTGCGTTTTTGGAGCAACGATAACGCAGTCGTTGTAGAAGTCGGTCATCGTATATTTGATAACG
ACGGTATTGACGAGTCGCTTTGGCAGGTACTGGCGAAGCAACTACTTAAATACCGTCCGAGGCAAGGGCT
GAACGGCATTGTGACGGTTATTGGGTGTGATCGCCTAATGACAGGAGACAAAAAAGAACGCACTAGGCTC
TCAGGCATCTATCAGGAGGCTGTGTTGTCGATGGGCGCAGAGCTTAGCTTAAACTTGCCTGTTTATGCCG
CTTTCTCTAAAGCTGACTCGATAGCAGACTTCACTGGTTTCTTTGAGAGCTTCACTGCATGTGACTCAGA
AAATCCTTTTGGTATTACCTTTGAATGCGATGTTTCACGTCGTTATGACAAACAGCAGTTTGAGGCAGAA
AGCCACGCGTTGATTCAATCCATTGCGGGGCAGCAGTTTGAGTTACTGAGAAACGTCAGCAGTGACAAGT
CGGGCTCTATTATCGCTTGGCCTTATCAGCTAAGAATTTTCCTAGAGCGCGTCAACGAGTTTTTGAGCGA
CATTGGTCGCGAGAACCGTGTCCGAGAAGCCGTATGGATCCGCGGCGCTTATTTAATGTCATCCGGACAA
AAAGGCATTGAGCACGATTTACTAACACAGGTAGTGGCCGAACGTGCTGAGTTCAACACCAATAATCAAG
TTGAACAGCAGCCAAATCGTCGTGGTTTCTTTACGCAACGTTTGTTCAATAAGGTCATCTTGCCGGAGAA
GAATATCGTCGGTGTTAATGAATGGCGTCATGCGGGTTATCTTGTATTTCGAACCGCTGTTCTAGTCTCC
GTGGTTGGGCTGATTTCTATTGCAGGTCTGAAGTTACAAGAAAACTGGAATGTTGATGAAGATTGGCGCA
CAACGGCTCTATCTCAAATTCGTTTTTATCAAAACGATGTTCAAAAGCTGAGCAATGACAATTCGATGTC
GGAGGTTGTGGCGGTATTAAGAGAACTCGGCGACGTGGTTGCTGAGGGCGTTCAACCTAAACCGTGGCAT
GAGAAAGTCAGTATTAAGCAAACAGATACGGCCGAGAGTGTTTACTCTGCTTATGAAAAACAGTTGCACC
AGATAATGCTGCCAAAGCTAGAAGAGCTGATCAGCAGCGAGCTGTATGTTTATGTGAACCTTGGTAATCC
AAGCCGAATCTTTGAGATTTTGCGTTACTACCAGATGTTGTTTGACCGAGAGCAACTGAACTTTGCGGAA
CTACAAACTTACTTACTTGATAACTTGAAAGACCAAGGTGAGCTTTCTCCGGACGAGCTTTACTCTTTTT
CTCTTTTAATCGAAGACCTGTTTAAAAGTCAGT
 Primer design