SecReT6
Protein ID: 239813211
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0192
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]199429..200520 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDC5CX51
KEGG IDvap:Vapar_0192
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-17, Aligned region: 57..115
Protein Sequence: 363 a.a.     [Download]
>gi|239813211|ref|YP_002942121.1| ImpA family type VI secretion-associated protein [Variovorax paradoxus S110]
MGLPPSEIELLQSPVEGPLPCGEDLEYDPDFMALQQAATGKREQQFGSTIIPAEPPDWARVERIAKQLCQ
RTLDVRVLVLLTLAWTESRGLPGYVDGLRVVDGILQKFWNDVHPRVVDGDFEDPLPRMNALAALAEAEGL
GRSVRDARLLEDAGASMSLRQVEALLDSSKADQIDYPGGIGRLREVARRAQEKAAPAVVALHAALELLRR
IRETSERALGQSWAPDFSRLERSLRTVVQLLPEQAQPEPAEASQAAAQGHGSAPAAPSAQGAAALGHGAS
GARAASIKDIEISTRDDVQVLLEKACQYMERTEPSHPAPMLIRRAQRLLDLNFFQIIEELVPEGLQKIES
LAGRSLSGGSAAE
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|239813019|ref|NC_012791.1|:199429-200520 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGGGTTGCCGCCGAGCGAGATCGAACTACTGCAGTCGCCTGTTGAAGGCCCGCTTCCGTGCGGTGAAG
ACCTCGAATACGACCCCGATTTCATGGCGTTGCAGCAAGCGGCAACGGGAAAGCGGGAGCAGCAGTTCGG
CTCGACCATCATTCCGGCCGAGCCGCCCGACTGGGCCCGCGTCGAGCGCATTGCCAAGCAGCTGTGCCAG
CGCACGCTCGACGTGCGCGTGCTGGTTCTGCTGACGCTGGCGTGGACCGAGAGCCGGGGATTGCCGGGCT
ACGTCGATGGCTTGCGCGTGGTGGACGGCATCCTGCAGAAGTTCTGGAACGACGTGCATCCGCGCGTTGT
CGATGGCGATTTCGAAGACCCGCTGCCGCGCATGAATGCGCTGGCTGCATTGGCCGAAGCCGAGGGGCTC
GGGCGCAGCGTGCGCGATGCGCGCCTGCTCGAGGATGCCGGCGCGTCGATGAGCCTGCGGCAGGTCGAGG
CCCTGCTCGACTCGAGCAAGGCCGACCAGATCGATTACCCGGGCGGCATCGGCCGGCTGCGGGAAGTGGC
GCGCCGCGCGCAGGAGAAGGCGGCGCCCGCGGTGGTGGCATTGCATGCGGCGCTGGAGCTGCTGCGGCGC
ATCCGGGAGACCTCGGAGCGGGCCCTGGGACAGAGCTGGGCCCCCGATTTCTCCCGGCTCGAACGCTCGC
TTCGCACCGTGGTCCAGCTGCTGCCCGAGCAGGCCCAGCCGGAGCCGGCCGAAGCATCGCAGGCGGCAGC
GCAAGGCCATGGGTCGGCGCCGGCCGCTCCTTCGGCGCAGGGCGCTGCGGCCTTGGGCCATGGCGCCTCC
GGTGCGCGTGCGGCAAGCATTAAAGATATTGAAATATCGACTCGTGATGATGTGCAGGTCTTGTTGGAAA
AGGCGTGCCAGTACATGGAACGCACCGAGCCCAGCCACCCGGCCCCCATGCTCATCCGCAGAGCGCAAAG
GCTGCTGGACCTCAACTTTTTCCAGATCATCGAAGAACTCGTTCCCGAGGGCCTGCAGAAGATCGAAAGC
CTGGCCGGCCGCTCGCTGAGCGGCGGGTCGGCAGCGGAGTGA
 Primer design