SecReT6
Protein ID: 239813212
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0193
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]200601..201170 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDC5CX52
KEGG IDvap:Vapar_0193
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.90E-59, Aligned region: 14..166
Protein Sequence: 189 a.a.     [Download]
>gi|239813212|ref|YP_002942122.1| type VI secretion protein [Variovorax paradoxus S110]
MADNRVRNSGQKFIARNRAPRVQIEYDVEIYGSERKIQLPFVMGVIADLAGKQVDPMPDLAERDFMAVDI
DNFDDRMKAIKPRVAFQVPNTLTGEGQMNVDITFDSMDDFSPARIARQVGALQHLLEARTELSNLLSYMD
GKNGAEQLIAQALQNPELLKSLASAPNPAVAKAIEAANEKSGNPGTPSE
 
Nucleotide Sequence: 570 bp     [Download]
>gi|239813019|ref|NC_012791.1|:200601-201170 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGCAGACAACCGTGTCAGAAACAGTGGTCAGAAGTTCATCGCGCGCAACCGGGCACCCCGCGTGCAGA
TCGAGTACGACGTCGAGATCTACGGCAGCGAGCGCAAGATCCAGCTGCCCTTCGTGATGGGCGTGATCGC
CGATCTCGCGGGCAAGCAGGTCGACCCGATGCCCGACCTTGCCGAGCGCGACTTCATGGCGGTGGACATC
GACAACTTCGACGACCGCATGAAGGCCATCAAGCCGCGCGTGGCCTTCCAGGTGCCCAACACCCTCACGG
GCGAAGGGCAGATGAACGTCGACATCACCTTCGACAGCATGGATGACTTCTCGCCCGCGCGCATCGCCCG
CCAGGTCGGCGCGCTGCAGCATCTGCTGGAAGCGCGCACCGAGCTTTCCAACCTGCTGTCCTACATGGAC
GGCAAGAACGGCGCCGAGCAGCTGATCGCCCAGGCGCTGCAGAACCCGGAGCTGCTCAAGTCGCTCGCAT
CCGCACCCAATCCCGCCGTTGCCAAGGCGATCGAGGCCGCGAACGAAAAGTCGGGCAACCCCGGCACCCC
TTCCGAGTAA
 Primer design