SecReT6
Protein ID: 239813213
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0194
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]201189..202697 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDC5CX53
KEGG IDvap:Vapar_0194
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.20E-194, Aligned region: 70..495
Protein Sequence: 502 a.a.     [Download]
>gi|239813213|ref|YP_002942123.1| EvpB family type VI secretion protein [Variovorax paradoxus S110]
MSTAPKQTARGQAATIEALEPNEFSDLLQREFKPKTDQAREAVQSAVKTLAVQALESTVTISNDAYRTVQ
AIITEIDRKLSEQINQILHHEDFQQLEGAWRGLHYLVNNTETDEQLKIRVMCASKREVARSLKRHKGIGW
DQSPLFKKIYEAEYGQFGGEPFGALIGDFHFDHSPPDVEMLGEMAKIAAAAHCPFIAGASPTVMQMDSWQ
ELSNPRDLTKIFQNTEHTAWRSLRESEDARYIGLAMPRFLARLPYGARTNPVDEFEFEEETDSALHNRYT
WANSAYAMGVNINRSFKQFGWCTSIRGVESGGAVENLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFMPLVHRKNSDFAAFIGAQSLQQPAEYYDADATANANLAARLPYLFACCRFAHYLKCIVRDKIGSFRER
EDMERWLNDWIMNYVDGSPGTSSQDTKAMKPLAAAEVQVEAIEDNPGYYAAKFFLRPHYQLEGLTVSLRL
VSKLPSNKKDSS
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|239813019|ref|NC_012791.1|:201189-202697 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGAGCACTGCACCCAAACAGACAGCGCGCGGACAGGCCGCCACCATCGAAGCGCTCGAGCCCAACGAGT
TCTCCGACCTCCTGCAGCGCGAGTTCAAGCCCAAGACCGACCAGGCGCGCGAGGCGGTGCAAAGCGCCGT
CAAGACGCTGGCGGTGCAGGCGCTTGAAAGCACCGTCACCATCTCGAACGATGCCTACCGCACCGTGCAG
GCGATCATCACCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCAGATCCTGCACCACGAAGACTTCC
AGCAGCTCGAAGGCGCATGGCGCGGCCTGCACTACCTGGTCAACAACACCGAGACCGACGAGCAGCTCAA
GATCCGCGTGATGTGCGCCTCCAAGCGCGAAGTGGCGCGCTCGCTCAAGCGCCATAAGGGCATCGGCTGG
GACCAGAGCCCGCTGTTCAAGAAGATCTATGAGGCCGAGTACGGCCAGTTCGGTGGCGAGCCCTTCGGCG
CGCTGATCGGCGACTTCCACTTCGACCACAGCCCGCCCGATGTCGAGATGCTCGGCGAAATGGCCAAGAT
CGCCGCGGCCGCGCACTGCCCCTTCATTGCCGGCGCATCGCCCACCGTGATGCAGATGGATTCGTGGCAG
GAACTGTCGAACCCGCGCGACCTCACCAAGATCTTCCAGAACACCGAGCACACGGCCTGGCGGTCGCTGC
GCGAGTCGGAAGACGCGCGCTACATCGGCCTGGCCATGCCGCGCTTCCTGGCGCGCCTGCCGTACGGCGC
GCGCACCAATCCGGTCGACGAGTTCGAGTTCGAGGAAGAAACCGACTCGGCCCTGCACAACCGCTACACC
TGGGCCAATTCGGCCTACGCGATGGGCGTGAACATCAACCGCTCGTTCAAGCAGTTCGGCTGGTGCACGT
CGATCCGCGGCGTGGAGTCGGGCGGCGCGGTCGAGAACCTGCCCACCCACACCTTCCCGACCGACGATGG
CGGCGTGGACATGAAGTGCCCCACCGAGATCGCCATCAGCGACCGGCGCGAGGCCGAGCTCGCCAAGAAC
GGCTTCATGCCGCTGGTGCACCGCAAGAACTCCGACTTCGCGGCCTTCATCGGCGCGCAGTCGCTGCAGC
AGCCGGCCGAGTACTACGACGCGGATGCCACGGCCAATGCCAACCTGGCGGCGCGCCTGCCTTACCTGTT
CGCATGCTGCCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCCGCGAGCGC
GAGGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTGGACGGCAGCCCCGGCACGTCGTCCC
AGGATACGAAGGCAATGAAGCCGCTGGCGGCGGCCGAAGTCCAGGTGGAAGCCATCGAGGACAACCCCGG
CTACTACGCCGCCAAGTTTTTTCTCCGGCCGCACTATCAGCTCGAAGGGCTGACGGTGTCATTGCGGCTG
GTTTCGAAGCTGCCATCCAACAAGAAGGACAGCAGCTAG
 Primer design