SecReT6
Protein ID: 239813214
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0195
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]202747..203229 [+]
Producthypothetical protein
NoteTssD
UniProt IDC5CX54
KEGG IDvap:Vapar_0195
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.30E-35, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|239813214|ref|YP_002942124.1| hypothetical protein Vapar_0195 [Variovorax paradoxus S110]
MAVDMFMRVEGANGESKDSNHKDWTDIKSFAWGATQPGNMVSGGGGGVGKASFNDLQVLARIDKAAPSVM
KNCASGKHLSKVEVSVCKAGGSQIEYTRVTLEEVLVTSVQYSAEQGGDAVLVQFAFQAAKVKQQYWEQTD
KGGKGAETVLAWNIKENREA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|239813019|ref|NC_012791.1|:202747-203229 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGCAGTAGACATGTTCATGCGCGTCGAGGGCGCGAACGGCGAATCCAAGGACTCGAACCACAAGGACT
GGACCGATATCAAGTCGTTCGCATGGGGAGCAACGCAGCCTGGCAACATGGTCAGCGGCGGCGGTGGCGG
TGTGGGCAAGGCGAGCTTCAACGACCTGCAGGTGCTCGCGCGCATCGACAAGGCGGCGCCGTCGGTGATG
AAGAACTGCGCGAGCGGCAAGCACCTGAGCAAGGTGGAAGTGTCGGTGTGCAAGGCCGGGGGCTCGCAGA
TCGAATACACGCGCGTGACGCTGGAAGAAGTGCTGGTCACCTCGGTGCAGTACTCGGCCGAGCAGGGCGG
CGATGCGGTGCTGGTGCAGTTCGCCTTCCAGGCGGCCAAGGTCAAGCAGCAGTACTGGGAGCAGACCGAC
AAGGGCGGCAAGGGCGCTGAAACCGTGCTGGCCTGGAACATCAAGGAAAACCGGGAAGCCTGA
 Primer design