SecReT6
Protein ID: 239813215
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0196
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]203343..204209 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDC5CX55
KEGG IDvap:Vapar_0196
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.80E-35, Aligned region: 159..280
TPR_19 [PF14559], Evalue: 0.0009, Aligned region: 18..63
TPR_19 [PF14559], Evalue: 0.0009, Aligned region: 116..130
TPR_11 [PF13414], Evalue: 0.0016, Aligned region: 34..79
Protein Sequence: 288 a.a.     [Download]
>gi|239813215|ref|YP_002942125.1| virulence protein SciE type [Variovorax paradoxus S110]
MGDGFAVLGERSVAEHTEWVQRQIRASPQNAGLRLALGHFLALRGDWQRAEDQLKLAAKIDPSFAPASAT
CAMALAAERHRTEFWSGGRAPAVVAGEAGWVAALIAAAALPPERDAEAAELREAARQDAPALQGTLSCVD
RSDSRAVQAIDGEPVQSIEFAWLCDGDARMGAALELLTPSGYAWLPLPAVRRLKFSRPQHLVDLLWAPAE
IVLHDGRGLNGLVPVRYPGALEALDDETTLGRRTDWLPLAGEDQYAGVGQRTLISEAGDHSLLDIRLVEF
APAESAAQ
 
Nucleotide Sequence: 867 bp     [Download]
>gi|239813019|ref|NC_012791.1|:203343-204209 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGGCGATGGGTTTGCAGTGCTGGGCGAGCGCTCCGTGGCCGAACACACCGAATGGGTACAGCGGCAGA
TTCGCGCGAGTCCACAGAATGCCGGCCTGCGGCTTGCCCTCGGCCACTTTCTTGCGCTGCGGGGCGACTG
GCAGCGGGCTGAAGACCAGCTCAAGCTGGCCGCGAAGATCGATCCTTCCTTCGCTCCCGCCAGTGCCACC
TGCGCAATGGCGCTGGCCGCCGAGCGGCATCGAACCGAATTCTGGAGCGGCGGCCGTGCGCCGGCCGTCG
TGGCCGGCGAGGCCGGCTGGGTCGCGGCGCTGATTGCTGCCGCCGCCCTGCCGCCCGAACGCGACGCCGA
AGCGGCCGAGCTGCGCGAAGCCGCGCGGCAGGATGCGCCCGCATTGCAGGGCACGCTGAGCTGCGTCGAC
CGGTCGGACTCCCGCGCCGTGCAGGCCATCGACGGCGAGCCGGTGCAAAGCATTGAGTTCGCCTGGCTTT
GCGACGGCGACGCGCGCATGGGCGCCGCGCTCGAGCTCCTCACGCCTTCGGGCTATGCGTGGCTGCCGCT
GCCGGCGGTGCGCCGCCTCAAGTTCTCCCGTCCGCAGCACCTGGTCGACCTGCTCTGGGCGCCGGCCGAG
ATCGTGCTGCATGACGGCCGCGGGCTCAACGGCCTGGTGCCGGTGCGCTATCCCGGCGCGCTCGAGGCGC
TGGACGACGAAACAACCCTGGGCCGCCGCACCGACTGGCTGCCGCTGGCCGGCGAGGACCAATACGCCGG
CGTGGGCCAGCGCACGCTGATCAGCGAAGCCGGCGACCATTCGCTGCTCGACATCCGGCTGGTCGAGTTC
GCGCCTGCCGAGAGTGCTGCGCAGTGA
 Primer design