SecReT6
Protein ID: 239813216
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0197
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]204239..204766 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC5CX56
KEGG IDvap:Vapar_0197
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.40E-19, Aligned region: 46..151
Protein Sequence: 175 a.a.     [Download]
>gi|239813216|ref|YP_002942126.1| type VI secretion system lysozyme-like protein [Variovorax paradoxus S110]
MEADGDQQESVARDRLQPVLLDRLTDKQPQSRQERAGAFLMSGKLLRDSVLRDLQWLLNTTNFGADHTIN
AMPRARRSVVNYGVRGWAGGRMSEVDFADVEAAIRAAIIDFEPRIMKDSIDVRCVTDATDLEHHNLLALE
IRGTLWSVPYPIEFILRSELDLESGHMVLRPTGGL
 
Nucleotide Sequence: 528 bp     [Download]
>gi|239813019|ref|NC_012791.1|:204239-204766 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGAGGCCGACGGCGACCAGCAAGAAAGCGTTGCACGTGACCGCCTGCAGCCCGTGCTGCTCGACCGCC
TGACCGACAAGCAGCCGCAAAGCCGCCAGGAGCGCGCGGGCGCATTCCTCATGAGCGGCAAGCTGCTGCG
CGACTCGGTGCTGCGCGACCTGCAGTGGCTGCTCAACACCACCAACTTCGGCGCGGACCACACCATCAAC
GCCATGCCGCGCGCGCGGCGCTCGGTGGTGAACTACGGCGTGCGCGGCTGGGCCGGCGGACGCATGTCGG
AGGTCGACTTCGCGGACGTCGAGGCCGCCATCCGCGCCGCGATCATCGACTTCGAGCCGCGCATCATGAA
GGACAGCATCGACGTGCGCTGCGTCACCGACGCCACCGACCTGGAGCACCACAACCTGCTCGCGCTCGAG
ATCCGCGGCACCTTGTGGTCGGTGCCCTACCCGATCGAATTCATCCTGCGCTCCGAGCTCGACCTCGAGA
GCGGCCACATGGTCCTGCGCCCGACGGGAGGGCTCTGA
 Primer design