SecReT6
Protein ID: 239813217
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0198
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]204767..206638 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDC5CX57
KEGG IDvap:Vapar_0198
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-212, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|239813217|ref|YP_002942127.1| type VI secretion protein [Variovorax paradoxus S110]
MDARLLDYYNRELTYMHELGAEFAQRYPKIAGRLGMRGIEVSDPYVERLLEGFSFLTARIQLKMDAEFPR
FSQRLLEVVYPNFLAPLPAMAVVQIDGNLNEGSLKAGYELPRHTIMRGRMIKGEQTACEFRTGHEVTLWP
IRIADASIGPVPAEIAHAMPAVAQRARSAITIKLEAVGGTTFAEMPIERLEFFLSGAELHALRVLELAVH
HSIGTVCRSGPGSKARIVPLGDEAIRHEGFDPEQALLPYDARSFQGYRLLHEYFAFPDRYLFFSVKNLRA
AASAMGGTTMEIVILLDRADADLERLVDAKHFSLFCTPIINLVPRRSDRIPVGPGQHEHHAVIDRTRPRD
FEIFTVERVTGHMASGSEEREFRPFLGSFAADDGDFGAYFSLRREPRLVSDRARAQGTRTSYTGSEVYVS
LVDQHDAPFPHSLRHITIDALCTNRDLPLLLPTGLESDFSLRVSAPVRGIRILRGPSRPYPALAEGALTW
RLISHLGLNYLSLTDVDATQGAAALREMLDLYGNLADPAVRRQIQGVRSMALAPVFRRLPEPGPIVFGRG
VEIALKIDEVAFSGASPYLFGAVLEQFFSRHVSLNAFTEFALSSLQRGEIARWTPRIGRRPAV
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|239813019|ref|NC_012791.1|:204767-206638 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGACGCCAGGCTGCTCGACTACTACAACCGCGAGCTCACCTACATGCACGAGCTCGGCGCCGAGTTCG
CGCAGCGCTACCCGAAGATCGCCGGGCGGCTGGGCATGCGCGGCATCGAGGTCAGCGACCCCTACGTGGA
GCGCCTGCTCGAGGGCTTCAGCTTTCTCACGGCGCGCATCCAGCTCAAGATGGATGCGGAGTTTCCGCGC
TTCTCGCAGCGGCTGCTCGAGGTGGTGTACCCCAACTTCCTCGCGCCGCTGCCGGCCATGGCCGTGGTGC
AGATCGACGGCAACCTCAACGAGGGCTCGCTGAAGGCCGGCTACGAGCTGCCGCGCCACACGATCATGCG
CGGACGCATGATCAAGGGCGAGCAGACGGCCTGCGAATTCCGCACCGGCCACGAGGTCACGCTGTGGCCC
ATCAGGATCGCGGATGCGAGCATCGGCCCCGTGCCCGCGGAAATCGCGCATGCGATGCCCGCGGTGGCCC
AGCGCGCCAGGAGCGCGATCACCATCAAGCTCGAAGCGGTGGGCGGCACCACCTTTGCCGAGATGCCGAT
CGAGCGGCTCGAGTTCTTTCTTTCGGGCGCGGAGCTGCATGCGCTGCGCGTGCTCGAGCTTGCGGTGCAC
CACAGCATCGGCACCGTGTGCCGCAGCGGCCCGGGCAGCAAGGCGCGCATCGTTCCGCTCGGCGACGAAG
CCATTCGCCACGAGGGCTTCGATCCCGAGCAGGCGCTGCTGCCTTATGACGCGCGCTCGTTCCAGGGCTA
CCGGCTGCTGCACGAATACTTCGCCTTCCCCGACCGCTACCTGTTCTTCAGCGTGAAGAACCTGCGCGCG
GCGGCCTCGGCCATGGGCGGCACCACGATGGAAATCGTGATCCTGCTCGACCGCGCCGACGCCGACCTGG
AGCGGCTGGTCGATGCCAAGCACTTCTCGCTGTTCTGCACGCCCATCATCAACCTGGTGCCGCGCCGCAG
CGACCGCATTCCGGTGGGCCCCGGGCAGCACGAGCACCATGCGGTGATCGACCGCACGCGCCCGCGCGAC
TTCGAAATCTTCACGGTCGAGCGCGTCACCGGCCACATGGCGAGCGGCTCGGAAGAGCGCGAGTTCAGGC
CGTTCCTTGGCTCGTTCGCTGCCGACGACGGCGACTTCGGCGCGTACTTCTCGCTGCGCCGCGAGCCGCG
CCTGGTGTCCGACCGCGCACGCGCGCAGGGCACGCGCACCAGCTACACCGGCAGCGAGGTGTACGTGTCG
CTGGTCGACCAGCACGACGCGCCCTTTCCGCACAGCCTGCGCCACATCACCATCGACGCGCTGTGCACCA
ACCGCGACCTGCCGCTGCTGCTGCCCACCGGGCTGGAGTCGGACTTCTCGCTGCGCGTGTCGGCGCCGGT
GCGCGGCATCCGCATCCTGCGCGGGCCGTCGCGGCCCTATCCGGCGCTGGCGGAGGGTGCGCTCACCTGG
CGCCTGATCAGCCACCTGGGCCTCAACTACCTGAGCCTGACCGACGTCGACGCCACGCAGGGCGCGGCCG
CATTGCGCGAGATGCTCGACCTCTACGGCAACCTGGCCGACCCGGCGGTGCGCCGCCAGATCCAGGGCGT
GCGCTCGATGGCGCTGGCGCCGGTGTTCCGCCGCCTGCCCGAGCCGGGGCCGATCGTCTTCGGGCGCGGG
GTGGAAATCGCGCTGAAGATCGACGAAGTGGCCTTCTCGGGCGCGAGCCCCTATCTCTTCGGCGCCGTGC
TCGAGCAGTTCTTCAGCCGGCACGTGTCGCTCAACGCGTTCACCGAGTTCGCGCTCTCCAGCCTGCAGCG
CGGCGAGATCGCGCGCTGGACGCCGCGCATCGGACGCCGTCCCGCCGTATGA
 Primer design