SecReT6
Protein ID: 239813218
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0199
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]206635..207801 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDC5CX58
KEGG IDvap:Vapar_0199
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-111, Aligned region: 50..352
Protein Sequence: 388 a.a.     [Download]
>gi|239813218|ref|YP_002942128.1| type VI secretion protein [Variovorax paradoxus S110]
MSMRTTAELADDSQQAPPAAIEHAAPEHAAAPARRGAAEADPVLWAGLVDQPFEHDLFMLLRRLDAHGSH
PLLGRAPRPLDEPLRLGQEPSMAFAPSNVSGVDVDGDGPPRISIYGFGLFGPNGPLPLHLTEYARERKRH
HSDNTLSAFADLFHHRLILLFYRAWADAQSVNSLDRPDGHRFVDYVASLMNMGQPGLKARDRIADHARTF
MAGHLVRQTRNPEGLIQILRLYFDVPVRVEEFVSDWVMLDEREISRIGTSGRNQKLGAGATVGLAVRDAQ
GKFRLELGPLSQREFRDFLPGSKRLQQVVDWVRQYVGIEFAWELRLVLKKQEALGMQLGSDQRLGWGSWL
GTRLSPTDAGDMLFQPEALYSRSASAASAAAEASSMAL
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|239813019|ref|NC_012791.1|:206635-207801 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGAGCATGCGCACCACGGCCGAGCTCGCCGACGATTCGCAGCAGGCGCCGCCGGCTGCGATCGAGCATG
CCGCGCCCGAGCATGCCGCGGCACCCGCGCGGCGCGGTGCGGCCGAAGCCGATCCGGTCCTGTGGGCCGG
CCTGGTCGACCAGCCTTTCGAGCACGACCTGTTCATGCTGCTGCGCCGCCTCGATGCGCACGGCAGCCAT
CCGCTGCTGGGCCGCGCGCCGCGCCCGCTCGACGAGCCTTTGCGGCTGGGCCAGGAGCCGTCGATGGCCT
TTGCGCCCTCGAACGTCTCGGGCGTCGATGTCGACGGCGACGGCCCGCCGCGCATCTCGATCTACGGCTT
CGGCCTGTTCGGCCCCAACGGGCCGCTGCCGCTGCACCTGACCGAGTACGCGCGCGAACGCAAGCGCCAC
CACAGCGACAACACGCTCAGCGCCTTCGCCGACCTGTTCCACCACCGGCTCATCCTGCTGTTCTACCGGG
CCTGGGCCGATGCCCAGTCGGTCAACAGCCTGGACCGCCCCGACGGCCACCGCTTCGTCGACTACGTGGC
CAGCCTCATGAACATGGGGCAGCCGGGCCTCAAGGCGCGCGACCGCATCGCCGACCATGCGCGCACCTTC
ATGGCCGGGCACCTCGTGCGCCAGACGCGCAACCCCGAGGGGCTGATCCAGATCCTGCGGCTGTATTTCG
ACGTGCCTGTGCGCGTCGAGGAGTTCGTGAGCGACTGGGTGATGCTCGACGAGCGCGAGATCAGCCGCAT
CGGCACTTCCGGGCGCAACCAGAAGCTGGGCGCCGGCGCCACCGTCGGGCTGGCGGTGCGCGATGCGCAG
GGCAAGTTCAGGCTCGAACTCGGGCCGCTCTCGCAGCGCGAGTTCCGCGACTTCCTGCCGGGCAGCAAGC
GCCTGCAGCAGGTGGTCGACTGGGTGCGCCAGTACGTGGGCATCGAGTTCGCGTGGGAGCTGCGCCTCGT
GCTCAAGAAGCAGGAAGCCCTCGGCATGCAGCTGGGCAGCGACCAGCGCCTGGGCTGGGGCAGCTGGCTC
GGCACGCGCCTCTCGCCCACCGACGCCGGCGACATGCTGTTCCAGCCCGAAGCCCTGTATTCCCGTTCCG
CATCGGCTGCTTCCGCGGCGGCCGAAGCCTCTTCCATGGCCTTATGA
 Primer design