SecReT6
Protein ID: 239813219
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0200
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]207798..210524 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC5CX59
KEGG IDvap:Vapar_0200
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.20E-41, Aligned region: 229..270
AAA_2 [PF07724], Evalue: 4.20E-41, Aligned region: 638..804
AAA [PF00004], Evalue: 1.50E-19, Aligned region: 231..362
AAA [PF00004], Evalue: 1.50E-19, Aligned region: 644..728
AAA_5 [PF07728], Evalue: 6.10E-15, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 6.10E-15, Aligned region: 356..391
AAA_5 [PF07728], Evalue: 6.10E-15, Aligned region: 643..762
ClpB_D2-small [PF10431], Evalue: 3.80E-14, Aligned region: 811..885
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 36..77
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 208..253
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 269..309
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 469..500
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 634..681
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 799..826
Sigma54_activat [PF00158], Evalue: 2.40E-08, Aligned region: 225..310
Sigma54_activat [PF00158], Evalue: 2.40E-08, Aligned region: 642..760
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 231..311
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 360..395
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 642..665
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 705..726
AAA_17 [PF13207], Evalue: 8.00E-07, Aligned region: 231..294
AAA_17 [PF13207], Evalue: 8.00E-07, Aligned region: 642..679
AAA_19 [PF13245], Evalue: 2.70E-06, Aligned region: 230..254
AAA_19 [PF13245], Evalue: 2.70E-06, Aligned region: 373..407
AAA_19 [PF13245], Evalue: 2.70E-06, Aligned region: 641..665
AAA_18 [PF13238], Evalue: 4.50E-06, Aligned region: 231..269
AAA_18 [PF13238], Evalue: 4.50E-06, Aligned region: 644..684
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 229..255
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 284..318
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 619..668
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 231..253
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 317..399
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 636..693
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 818..854
Arch_ATPase [PF01637], Evalue: 2.30E-05, Aligned region: 209..251
Arch_ATPase [PF01637], Evalue: 2.30E-05, Aligned region: 283..328
Arch_ATPase [PF01637], Evalue: 2.30E-05, Aligned region: 642..662
NACHT [PF05729], Evalue: 2.80E-05, Aligned region: 231..275
NACHT [PF05729], Evalue: 2.80E-05, Aligned region: 643..673
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 215..250
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 643..663
AAA_29 [PF13555], Evalue: 5.60E-05, Aligned region: 223..249
AAA_29 [PF13555], Evalue: 5.60E-05, Aligned region: 641..668
Clp_N [PF02861], Evalue: 5.80E-05, Aligned region: 26..75
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 231..364
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 642..753
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 232..252
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 644..665
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 741..762
T2SE [PF00437], Evalue: 0.0037, Aligned region: 216..251
T2SE [PF00437], Evalue: 0.0037, Aligned region: 627..720
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 231..253
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 282..308
NTPase_1 [PF03266], Evalue: 0.0044, Aligned region: 643..664
Hpr_kinase_C [PF07475], Evalue: 0.0072, Aligned region: 231..245
Hpr_kinase_C [PF07475], Evalue: 0.0072, Aligned region: 640..660
TIP49 [PF06068], Evalue: 0.0076, Aligned region: 231..252
TIP49 [PF06068], Evalue: 0.0076, Aligned region: 284..311
TIP49 [PF06068], Evalue: 0.0076, Aligned region: 643..679
TIP49 [PF06068], Evalue: 0.0076, Aligned region: 799..826
DUF815 [PF05673], Evalue: 0.0084, Aligned region: 224..307
DUF815 [PF05673], Evalue: 0.0084, Aligned region: 643..681
Protein Sequence: 908 a.a.     [Download]
>gi|239813219|ref|YP_002942129.1| type VI secretion ATPase, ClpV1 family [Variovorax paradoxus S110]
MTDIRRVSLFSKLNPMLYKALETATAFAKLRGNAYVELVHWLHQILQLQDSDLLRIVKRAGLNLDAVEQD
LVRALDRLPHGATSISDISEHVDNAVERAWVYASLRFEATSIRGAYLLAGIVKTPGLRQVLSGISREFDK
IVPDVLVAQLPAWTEGSPEDDFDAAAAPGQAAPAESHQGDGAAAGGSALAKYASDLTAKARAGELDPVYG
RDDEIRQIIDILMRRRQNNPLLTGEAGVGKTAVVEGLASRLAAGDVPPSLKDVSLWVLDPTLLQAGAGVK
GEFEQRLRQVIDEVEKSPKPIVLFVDEVHTLVGAGGTAGTGDAANLLKPALARGRLRTIGATTWSEYKKY
IEKDPALTRRFQTIQVHEPTESKAVVMLRGISAELEKHHGVLILDAALEAAVSLSHRYIPARQLPDKAVS
LLDTACARVALSQHALPAAIEDLHRRIEVLGIESGIAGREAAIGVGEHQRVEDIAAQVAVAQAELDLLEQ
RRAEESVLVERIVALRKLLSPDAVPVRAEAKEEEGDEAEAPVEAEPAPPEPERTPEEIRAELDQAQDKLV
QLQGESPLILAAVDAQAVATVVADWTGIPIGRMVRDDAQSVLRLGEILSARVVAQPDALETISRRIRTAR
ARLDNPNKPVGVFLLCGPSGVGKTETALALSEALYGGEQNLVTINMSEFQESHTVSTLKGAPPGYVGYGE
GGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVFDKGWMEDGEGRHIDFRNTVIIMTSNVGTDLVMQL
CEDPTLRPDPEPLAAALREPLLKVFAPALLGRLVVVPYYPLQADALHRIIRLQLDRIATRLDANHGIALD
YDNSAVELVARRCTAIESGGRMIDAILTHTILPRLSEEVIGATVSARKLAGVRLSAAGDDFRYEFSEA
 
Nucleotide Sequence: 2727 bp     [Download]
>gi|239813019|ref|NC_012791.1|:207798-210524 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGACCGATATCCGCCGCGTCTCCCTTTTCTCGAAACTCAATCCGATGCTCTACAAGGCATTGGAGACCG
CCACCGCCTTCGCCAAGCTGCGCGGCAATGCCTACGTGGAGCTGGTGCACTGGCTGCACCAGATCCTGCA
GTTGCAGGACAGCGACCTGCTGCGCATCGTCAAGCGCGCCGGCCTCAACCTCGATGCGGTCGAGCAGGAC
CTGGTGCGTGCGCTCGACCGGCTGCCGCACGGCGCCACCTCGATCAGCGACATCTCGGAGCACGTCGACA
ACGCCGTCGAGCGCGCCTGGGTCTATGCGAGCCTGCGCTTCGAGGCCACGTCGATCCGCGGTGCCTACCT
GCTCGCGGGCATCGTCAAGACGCCGGGGCTGCGCCAGGTGCTCTCGGGCATCTCGCGCGAGTTCGACAAG
ATCGTGCCCGACGTGCTCGTCGCGCAGCTTCCCGCATGGACCGAGGGCTCGCCCGAGGACGACTTCGACG
CCGCGGCCGCGCCGGGGCAAGCCGCCCCGGCGGAGTCCCACCAGGGCGACGGCGCCGCCGCGGGCGGCTC
GGCGCTGGCCAAGTACGCGAGCGACCTCACGGCCAAGGCGCGTGCGGGCGAGCTCGACCCGGTCTACGGC
CGCGACGACGAGATCCGCCAGATCATCGACATCCTGATGCGCCGGCGGCAGAACAATCCGCTGCTCACGG
GCGAGGCGGGCGTGGGCAAGACCGCGGTGGTCGAAGGCCTGGCCTCGCGGCTCGCGGCGGGCGACGTGCC
GCCCTCGCTCAAGGACGTGTCGCTGTGGGTGCTCGACCCCACGCTGCTGCAGGCCGGCGCGGGCGTGAAG
GGCGAGTTCGAGCAGCGGCTGCGCCAGGTGATCGACGAGGTCGAGAAAAGCCCCAAGCCCATCGTGCTGT
TCGTCGACGAGGTGCACACGCTGGTCGGCGCGGGCGGCACGGCCGGCACCGGCGATGCGGCCAACCTGCT
GAAGCCGGCGCTTGCGCGCGGGCGGCTTCGCACCATCGGCGCGACCACCTGGTCCGAGTACAAGAAGTAC
ATCGAGAAGGACCCGGCGCTCACGCGGCGCTTCCAGACCATCCAGGTGCACGAGCCCACCGAGTCCAAGG
CCGTGGTCATGCTGCGCGGCATCTCGGCCGAGCTCGAGAAGCACCATGGCGTGCTCATCCTGGACGCCGC
GCTCGAAGCGGCCGTGAGCCTGTCGCACCGCTACATCCCCGCGCGCCAGCTGCCCGACAAGGCCGTGAGC
CTGCTCGACACGGCCTGCGCGCGCGTGGCCCTGAGCCAGCATGCGCTGCCCGCGGCGATCGAAGACCTGC
ATCGCCGCATCGAGGTGCTGGGCATCGAGTCGGGCATTGCGGGGCGCGAGGCGGCGATCGGCGTCGGCGA
GCACCAGCGCGTGGAAGACATCGCGGCCCAGGTGGCTGTGGCACAGGCCGAGCTCGACCTGCTGGAACAG
CGGCGTGCGGAAGAAAGCGTGCTCGTGGAGCGCATCGTGGCGCTGCGCAAGCTGCTCTCGCCCGATGCAG
TGCCGGTGCGGGCCGAGGCCAAAGAGGAAGAGGGCGACGAAGCCGAAGCTCCAGTTGAAGCCGAGCCCGC
TCCGCCGGAACCCGAAAGAACACCCGAAGAGATCCGCGCCGAACTCGACCAGGCGCAGGACAAGCTCGTG
CAGCTGCAGGGCGAATCGCCGCTCATCCTGGCAGCCGTCGACGCGCAGGCCGTTGCCACCGTGGTGGCCG
ACTGGACCGGCATTCCGATCGGCCGCATGGTGCGCGACGATGCGCAGTCGGTGCTGCGCCTCGGCGAGAT
CCTCTCGGCCCGCGTGGTGGCCCAGCCCGACGCGCTGGAGACCATCTCGCGGCGCATCCGCACCGCGCGC
GCGCGGCTCGACAACCCGAACAAGCCGGTGGGCGTGTTCCTGCTGTGCGGCCCCTCGGGCGTGGGCAAGA
CCGAGACCGCGCTCGCGCTGTCGGAGGCGCTCTACGGCGGCGAGCAGAACCTGGTCACCATCAACATGAG
CGAGTTCCAGGAGTCGCACACCGTCTCCACGCTCAAGGGCGCGCCGCCCGGCTACGTGGGCTACGGCGAA
GGCGGCGTGCTCACCGAGGCCGTGCGCCGCCGGCCCTACAGCGTGGTGCTGCTCGACGAGATCGAGAAGG
CCCACCCCGACGTGCACGAGATCTTCTTCCAGGTGTTCGACAAGGGCTGGATGGAAGACGGCGAGGGCCG
CCACATCGACTTCCGCAACACCGTGATCATCATGACGTCGAACGTCGGCACCGACCTGGTCATGCAGCTG
TGCGAAGACCCGACCCTGCGCCCCGACCCCGAGCCGCTCGCGGCCGCGCTGCGCGAACCGCTGCTCAAGG
TGTTCGCGCCGGCGCTGCTGGGCCGGCTGGTTGTAGTGCCTTATTACCCGTTGCAAGCCGACGCATTGCA
TCGCATCATTCGCCTCCAGCTCGACCGCATTGCCACCCGCCTCGATGCGAACCATGGCATTGCGCTGGAC
TACGACAACAGCGCCGTCGAACTGGTGGCGCGCCGATGCACGGCCATCGAGTCGGGTGGGCGGATGATCG
ATGCGATCCTCACGCACACCATCCTGCCGCGATTGAGCGAAGAAGTCATCGGCGCCACCGTCAGTGCGCG
CAAGCTCGCCGGCGTGCGGCTGTCCGCAGCGGGCGACGACTTCCGGTACGAATTTTCCGAAGCCTAA
 Primer design