SecReT6
Protein ID: 239813220
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0201
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]210545..212878 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDC5CX60
KEGG IDvap:Vapar_0201
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-85, Aligned region: 24..327
Phage_base_V [PF04717], Evalue: 7.40E-20, Aligned region: 364..456
Protein Sequence: 777 a.a.     [Download]
>gi|239813220|ref|YP_002942130.1| type VI secretion system Vgr family protein [Variovorax paradoxus S110]
MARVVRAHTPLGEDQLQFRSMHGTEGLSQLFEFEVDLLSPSASIDMKAVLGKPMALEIQTAGTPRFLNGQ
VVRFSMIGREGGTSRHTVYRASVRPWLWYLTRSSDNKIFQNKTVVEVLEDVFGDYNFAFEKKLTGTYRQW
EHCVQYNETDFAFVSRLMELEGIYYYFKHDKNQHTLVLTDDVTMHEPMSGYETINYFAADRDVTEDMEVI
DNWQVTAEIRSGSYAVDDYNFTTPGADLSGARSMPQPYDHSGYEMYEWLGEYTNPGEGEHYARVRLEEAQ
SMAERSVGHATVRGMAPGYTFSMQNSPRSDDNREYLIVSVNYMLREGGYATGAAPGEYSFNFVVQPTSLP
FRAPRITQIPRTTGPQTAVVVGPEGEEIWTDQYGRVKVQFRWDRSGRRNENCSCFVRVSHVIAGDGFGAV
FTPRIGQEVVIDFVDGRADRPLVVGRVYNPRQMPPFNLPGEQTKSGFVTRSTPGGSPETANSLVFEDKMG
AEYVALHAERDLNVSVEKNETHDTGGTRTTVIVGHESATYKAGEERHITEGAVETIDGGETRTVTGGATE
TVSGGETRTISDGATETISGGETRTVSGGFTETISGGATETISGGVNSTITGGVTQTITGGVNETISGGL
TFMVNGGVTSNVLGNHTHVVTGGSTTTTTGPTINNAPDIVDNSDRRTINAGDNTVNAAKEGWWRNTDNHG
TLEHTGVNVAAVDVNGVKLQFSGVNGQFNGVFINLSVTSIIDAKFKYKLNPVGISTVGLSLKTGYIAVAF
KSLFMKA
 
Nucleotide Sequence: 2334 bp     [Download]
>gi|239813019|ref|NC_012791.1|:210545-212878 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGCCAGAGTCGTACGAGCGCACACCCCGCTTGGGGAAGACCAGCTCCAGTTCCGCTCGATGCATGGCA
CCGAGGGACTGTCGCAGTTGTTCGAATTCGAGGTCGACCTGCTGAGCCCGAGCGCGTCGATCGACATGAA
AGCGGTGCTCGGAAAACCCATGGCCCTGGAGATCCAGACAGCCGGCACGCCCCGTTTCCTGAACGGCCAG
GTGGTCCGCTTCTCCATGATCGGACGCGAAGGCGGTACCTCGCGCCACACCGTCTATCGTGCTTCGGTGC
GCCCATGGCTCTGGTATCTCACGCGCTCCAGCGACAACAAGATCTTCCAGAACAAGACGGTCGTCGAAGT
TCTCGAGGACGTATTCGGCGACTACAACTTCGCCTTCGAGAAGAAGCTCACCGGCACCTATCGCCAGTGG
GAGCACTGCGTGCAGTACAACGAGACGGACTTTGCCTTCGTGAGCCGGCTCATGGAACTCGAAGGCATCT
ACTACTACTTCAAGCACGACAAGAACCAGCATACGCTGGTGCTGACCGACGACGTCACGATGCACGAGCC
GATGTCCGGCTACGAAACCATCAATTACTTCGCGGCCGATCGCGACGTGACCGAGGACATGGAGGTCATC
GACAACTGGCAAGTGACGGCCGAGATCCGCTCGGGCAGCTATGCGGTGGATGACTACAACTTCACCACGC
CGGGCGCCGATCTGAGCGGTGCCCGCTCCATGCCGCAGCCGTACGACCACTCGGGCTATGAGATGTACGA
GTGGCTCGGCGAGTACACGAACCCCGGGGAAGGCGAGCACTATGCGCGCGTGCGGCTGGAAGAAGCGCAG
TCGATGGCCGAGCGCAGCGTGGGCCATGCCACGGTCCGGGGCATGGCGCCCGGCTACACCTTCTCGATGC
AGAACTCGCCGAGGTCGGACGACAACCGCGAGTACCTGATCGTTTCGGTGAACTACATGCTGCGCGAAGG
CGGCTACGCCACCGGAGCCGCACCGGGCGAATACAGCTTCAACTTTGTCGTCCAGCCGACGTCCCTGCCC
TTCAGGGCACCCCGGATCACGCAAATCCCCAGGACCACCGGTCCGCAGACCGCGGTGGTGGTCGGCCCCG
AAGGCGAGGAAATCTGGACCGACCAGTACGGCCGCGTCAAGGTGCAGTTCCGGTGGGACCGCAGCGGGCG
CCGCAACGAGAACTGCTCGTGCTTCGTGCGTGTGTCCCATGTCATCGCAGGCGACGGCTTCGGTGCTGTT
TTCACGCCGCGCATCGGCCAGGAAGTGGTGATCGATTTCGTCGACGGGCGGGCCGACCGGCCGCTCGTCG
TGGGGCGGGTCTACAACCCGCGCCAGATGCCACCCTTCAATCTGCCGGGCGAGCAGACCAAGAGCGGGTT
CGTCACGCGTTCTACGCCGGGCGGCTCGCCGGAAACCGCCAACTCGCTCGTCTTCGAAGACAAGATGGGC
GCTGAATACGTAGCGCTTCATGCAGAGCGCGACCTGAATGTCTCGGTGGAGAAGAACGAGACCCACGACA
CCGGTGGCACGCGCACGACCGTCATCGTGGGGCATGAATCGGCCACCTACAAAGCCGGCGAAGAACGTCA
TATCACCGAGGGCGCGGTGGAGACGATCGACGGCGGAGAGACTCGCACGGTGACCGGCGGAGCGACCGAG
ACAGTTTCCGGCGGCGAGACGCGGACGATTTCGGACGGCGCGACCGAGACGATCAGCGGCGGCGAAACGC
GCACTGTCAGCGGAGGGTTCACGGAAACCATCAGCGGTGGTGCGACCGAGACGATCAGTGGAGGTGTGAA
CTCGACGATCACCGGCGGCGTGACCCAGACGATCACGGGCGGCGTGAACGAGACCATCAGCGGCGGCCTT
ACCTTCATGGTGAATGGCGGGGTCACCAGCAACGTCCTGGGCAACCACACGCATGTCGTCACGGGGGGCA
GCACGACCACCACGACCGGACCCACGATCAATAACGCGCCGGACATTGTTGACAACTCGGACAGGCGGAC
GATCAATGCGGGCGACAACACCGTCAACGCAGCCAAGGAAGGCTGGTGGCGCAACACGGACAACCACGGA
ACGCTCGAACATACGGGCGTCAATGTGGCGGCAGTCGATGTCAATGGCGTGAAGCTGCAATTCTCGGGGG
TGAACGGCCAGTTCAACGGCGTCTTCATCAACCTGTCCGTGACCAGCATCATCGATGCGAAGTTCAAATA
CAAGCTCAATCCCGTTGGCATCTCGACAGTCGGACTCAGTCTCAAGACCGGCTACATCGCAGTGGCATTC
AAGAGCCTTTTCATGAAGGCCTGA
 Primer design