SecReT6
Protein ID: 239813227
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0208
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]219032..220969 [-]
ProductFHA domain containing protein
NoteFha
UniProt IDC5CX67
KEGG IDvap:Vapar_0208
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.70E-08, Aligned region: 27..95
Protein Sequence: 645 a.a.     [Download]
>gi|239813227|ref|YP_002942137.1| FHA domain containing protein [Variovorax paradoxus S110]
MRWTVIEHAGKPVAAGPSALLAAPGGTIGRSPDNHLVLPDEQRQISRLQATVRFDDSGAAVLRNMSAVLP
IGVNERTLQHEQEAPIAEGDRVTIGSYVLVAGSGQRTAPVEPAAPLMAAAPPPAAPVHSALPASTMAPAP
MDSLLPAAPVSDVFSDLFGAGALPIGETQPVTVAMPPPTVPAPPPAQVLAAAPVPAASPSPAPSPASAQA
STQASASQIPSAADWDAILANAPRREASASEPMPDPMAHEPFELPSQARRNPVDPLAELNPRAEDSMSDV
ALKRGMDPLSFFAADNDAPSPLSDPRPTALTHEDPLSDVHPAIDLLARPAAAPQGYSHSNHARELAAQFR
PPNPVPFDPPAAKPAEPRVSAQVEPPPSAPPPPPPPPPPPPPPPPPPPPAPVPVAAPRVENVAPPAPQQP
KPVAAPSPVAATPVPVAAPPSAPASSDELFRAFLEGAGVPDVAGQQPLDAEAMRRLGRLMRAFTDGTIEL
LSSRAMLKREVRAEITMIVDEENNPFKILPNGRAVLMQMFGARMPGFLSPEAAVHDALGDLQSHQLGMVA
GMRAALLTVLKRFDPAALNTATPHDGGLGEKLLPGGREARLWRQLQKLHAETTAAVEDDFQAVFGRAFQQ
AYDKEMERLKEARRA
 
Nucleotide Sequence: 1938 bp     [Download]
>gi|239813019|ref|NC_012791.1|:c220969-219032 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGCGTTGGACGGTGATCGAACATGCCGGCAAGCCGGTGGCTGCAGGCCCTTCGGCCTTGCTCGCGGCGC
CCGGCGGAACCATCGGGCGCAGCCCCGACAACCACCTGGTGCTGCCCGACGAGCAGCGCCAGATCTCGCG
CCTGCAGGCCACGGTGCGTTTCGACGACAGCGGCGCGGCGGTGCTGCGCAACATGAGCGCGGTGCTGCCC
ATCGGCGTCAACGAGCGCACGCTGCAGCACGAGCAGGAGGCGCCGATCGCCGAGGGCGACCGCGTGACCA
TCGGAAGCTATGTGCTGGTGGCGGGGAGCGGGCAACGCACCGCGCCCGTCGAGCCCGCCGCGCCGCTGAT
GGCGGCTGCACCGCCGCCGGCCGCGCCTGTGCACAGCGCATTGCCCGCCAGCACCATGGCGCCCGCGCCG
ATGGACTCGCTGCTGCCGGCCGCCCCCGTCTCCGATGTGTTCTCGGACCTCTTCGGCGCCGGCGCGCTGC
CGATCGGCGAGACGCAGCCCGTGACCGTGGCGATGCCGCCGCCGACCGTGCCGGCGCCACCGCCTGCACA
GGTACTGGCCGCTGCGCCGGTGCCTGCAGCATCGCCATCGCCAGCCCCCTCGCCGGCAAGCGCGCAGGCA
AGCACGCAGGCGAGCGCCTCGCAGATTCCCTCCGCCGCCGATTGGGATGCCATCCTCGCGAATGCGCCGC
GCCGCGAGGCGAGCGCCTCCGAGCCCATGCCCGACCCGATGGCGCACGAGCCCTTCGAGCTGCCCTCGCA
GGCACGCAGGAACCCGGTCGATCCGCTGGCCGAGCTGAATCCGCGTGCGGAAGACAGCATGTCCGACGTG
GCGCTCAAGCGCGGCATGGACCCGCTGTCCTTCTTTGCCGCCGACAACGACGCACCCTCGCCGCTCTCCG
ATCCGCGCCCCACCGCGCTGACCCACGAAGATCCGCTCAGCGATGTGCATCCGGCCATCGATCTGCTGGC
CAGGCCGGCGGCGGCCCCACAGGGCTACAGCCATTCGAACCATGCGCGGGAACTGGCGGCGCAGTTCAGG
CCGCCGAACCCGGTGCCCTTCGATCCGCCGGCTGCGAAGCCGGCCGAGCCGCGGGTGTCTGCGCAGGTTG
AGCCGCCACCTTCGGCGCCACCACCACCACCACCACCACCGCCACCGCCACCGCCACCACCCCCGCCGCC
ACCGCCGGCACCGGTGCCCGTCGCGGCCCCGCGCGTGGAGAATGTTGCGCCGCCCGCACCGCAGCAACCG
AAGCCTGTTGCCGCGCCCTCGCCCGTGGCCGCGACGCCAGTTCCTGTCGCGGCGCCGCCATCGGCCCCCG
CCTCTTCAGACGAACTCTTCAGGGCCTTCCTCGAAGGCGCCGGCGTGCCCGACGTGGCCGGCCAGCAGCC
GCTGGATGCCGAAGCCATGCGGCGCCTCGGCCGGCTCATGCGCGCGTTCACCGACGGCACCATCGAGCTG
CTCTCGTCGCGCGCCATGCTCAAGCGCGAAGTGCGTGCCGAGATCACGATGATCGTCGACGAGGAGAACA
ACCCCTTCAAGATCCTTCCCAACGGCCGCGCCGTGCTGATGCAGATGTTCGGCGCGCGCATGCCCGGCTT
CCTGTCGCCCGAGGCCGCCGTGCACGACGCGCTCGGCGACCTGCAGTCGCATCAGCTCGGCATGGTGGCC
GGCATGCGCGCCGCGCTGCTCACGGTGCTCAAGCGCTTCGATCCCGCGGCGCTCAACACCGCCACGCCGC
ACGACGGCGGGCTGGGCGAAAAACTGCTGCCCGGCGGCCGCGAGGCGCGCCTGTGGCGCCAGCTGCAGAA
GCTGCATGCAGAAACCACCGCGGCCGTCGAGGACGACTTCCAGGCCGTCTTCGGCCGGGCCTTCCAGCAG
GCCTACGACAAGGAGATGGAACGCTTGAAGGAGGCGCGCCGTGCTTGA
 Primer design