SecReT6
Protein ID: 239813229
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0210
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]221594..222064 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDC5CX69
KEGG IDvap:Vapar_0210
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-34, Aligned region: 4..150
Protein Sequence: 156 a.a.     [Download]
>gi|239813229|ref|YP_002942139.1| type VI secretion lipoprotein [Variovorax paradoxus S110]
MLGGLSGCASTAKSLPTPYAVTIKIDDGVNPDGRGQPAPILVKVFELKSSGNFETADYFALQDRDRETLA
AELVNADQAIMRSGEERVFKREAGLDSRAIGIIAGYRKLEAARWRIVLPLKEPKQTNLYKVWQFSPSEQN
VRIAIRKSGIELLPSR
 
Nucleotide Sequence: 471 bp     [Download]
>gi|239813019|ref|NC_012791.1|:221594-222064 Variovorax paradoxus S110 chromosome 1, complete sequence
TTGCTGGGTGGCCTCAGTGGATGCGCATCGACTGCGAAGTCATTGCCCACGCCCTATGCCGTGACGATCA
AGATCGACGATGGCGTCAACCCCGACGGACGCGGCCAGCCGGCACCGATTCTCGTCAAGGTCTTCGAATT
GAAATCTTCCGGTAACTTCGAGACGGCAGACTACTTTGCACTACAGGACCGCGACCGCGAAACGCTTGCA
GCGGAACTCGTGAACGCCGACCAGGCCATCATGCGCAGCGGTGAAGAGCGTGTGTTCAAGCGCGAGGCAG
GGCTCGACTCGCGTGCCATCGGCATCATCGCCGGCTACCGCAAGCTCGAGGCCGCACGCTGGCGCATCGT
GCTGCCGCTCAAGGAGCCGAAGCAAACCAATCTCTACAAGGTGTGGCAGTTTTCTCCGAGCGAGCAAAAC
GTGCGCATCGCGATCCGCAAGAGCGGCATCGAGTTACTACCAAGTCGTTAA
 Primer design