SecReT6
Protein ID: 239813230
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0211
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]222227..223603 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDC5CX70
KEGG IDvap:Vapar_0211
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-145, Aligned region: 34..457
Protein Sequence: 458 a.a.     [Download]
>gi|239813230|ref|YP_002942140.1| type VI secretion protein [Variovorax paradoxus S110]
MTVRNPGAGKQGALPQALANRVVWSEGMYLRPQHFQQLERYVEQYVTRRTAGLQGAYWGWLSLDIDRDAH
ALGRVSLLGGAGVLPDGTPFSFGAEDAPLPYEVPSDLTDELIVLALPLRRTGSEEVIFADDEGSAARFGV
IEREVADGNSVALGPAVLQLAKPRLRLARASSLTAEWQAIGAVRVIERRTDHKLVIDANYIPPVLDASAH
PMLRSMVAELHGLLTQRSEALASRLSQPGRGGVSEVSDFLLLELVNRYLATTWHAQHAVQVHPEELFIDW
FKLACHLATHTSPTRRPVVWPKYDHDNLNETIRPLMEELRRSLSAVLEQSAIAIELEERSHGVRVGRMPD
PVLVRNAGFVLAVHANLPADAIQQRFPTQVKIGSVERIRDLVQLQLPGVTVRPLPVAPRQIPYNAGYHYF
ELDKSGDMWRQLEKSGGVAMHLAGDFPGLAMEFWAIRP
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|239813019|ref|NC_012791.1|:222227-223603 Variovorax paradoxus S110 chromosome 1, complete sequence
GTGACAGTTCGCAATCCGGGTGCCGGCAAGCAGGGCGCCCTTCCGCAGGCGTTGGCGAATCGCGTGGTGT
GGTCCGAAGGCATGTACCTGCGGCCGCAGCACTTCCAGCAACTGGAGCGCTATGTCGAGCAGTACGTCAC
GCGCCGCACCGCAGGCCTGCAAGGTGCCTATTGGGGATGGCTCAGCCTGGACATCGATCGCGATGCCCAC
GCGCTCGGCCGCGTGTCGCTGCTCGGCGGCGCCGGTGTGCTGCCCGACGGCACGCCCTTCTCGTTCGGCG
CCGAAGATGCACCGCTGCCCTACGAGGTGCCGAGCGACCTGACCGATGAACTCATCGTGCTCGCGCTGCC
GCTGCGCCGCACCGGCAGCGAAGAGGTCATCTTTGCCGACGACGAGGGCTCGGCCGCGCGCTTCGGCGTG
ATCGAGCGCGAGGTGGCCGACGGCAATTCGGTGGCGCTCGGCCCGGCGGTGCTGCAGCTTGCGAAGCCGC
GCCTGCGGCTTGCGCGCGCGTCGTCGCTCACCGCGGAGTGGCAGGCCATCGGCGCGGTGCGCGTGATCGA
ACGGCGCACCGACCACAAGCTGGTGATCGACGCCAACTACATTCCGCCGGTGCTCGATGCATCGGCGCAC
CCCATGCTGCGCAGCATGGTTGCCGAACTGCACGGCCTGCTCACCCAGCGCTCCGAGGCGCTGGCCTCGC
GGCTCTCGCAGCCGGGCCGCGGCGGCGTGAGCGAGGTCTCCGACTTTCTTTTGCTCGAACTCGTCAACCG
CTATCTCGCCACGACCTGGCATGCGCAGCATGCGGTGCAGGTGCACCCCGAGGAACTGTTCATCGACTGG
TTCAAGCTGGCCTGCCATCTCGCCACGCACACCTCGCCCACGCGGCGCCCCGTGGTGTGGCCCAAGTACG
ACCACGACAATCTCAACGAGACCATCCGGCCGCTGATGGAAGAGCTGCGGCGCTCGCTCTCGGCGGTGCT
CGAACAGAGCGCCATCGCCATCGAGCTGGAGGAGCGCAGCCACGGCGTGCGCGTGGGCCGCATGCCCGAT
CCGGTGCTGGTGCGCAACGCGGGTTTCGTGCTCGCGGTGCATGCCAACCTGCCCGCCGATGCGATCCAGC
AGCGCTTTCCGACGCAGGTCAAGATCGGTTCGGTCGAGCGCATCCGCGACCTCGTGCAGCTGCAGCTGCC
GGGCGTCACGGTGCGGCCGCTGCCGGTGGCGCCGCGCCAGATTCCATACAACGCGGGCTACCACTATTTC
GAACTCGACAAGAGCGGCGACATGTGGCGCCAGCTCGAAAAATCGGGCGGCGTTGCAATGCACCTGGCCG
GCGACTTTCCGGGCCTGGCCATGGAGTTCTGGGCAATTCGTCCGTGA
 Primer design