SecReT6
Protein ID: 239813231
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0212
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]223612..224994 [+]
Producthypothetical protein
NoteTssL
UniProt IDC5CX71
KEGG IDvap:Vapar_0212
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-73, Aligned region: 70..274
DUF2077 [PF09850], Evalue: 4.00E-73, Aligned region: 409..445
OmpA [PF00691], Evalue: 1.00E-15, Aligned region: 338..436
RskA [PF10099], Evalue: 6.40E-05, Aligned region: 213..347
RskA [PF10099], Evalue: 6.40E-05, Aligned region: 411..449
Protein Sequence: 460 a.a.     [Download]
>gi|239813231|ref|YP_002942141.1| hypothetical protein Vapar_0212 [Variovorax paradoxus S110]
MNGVNDMAVGPGGFVPPNPGGGANNNGGNGDAAGMPPASRGAGQQQPQSFTAWHDARRPHAGDTALAGNN
PLVAAANPLLDLIPQIRATGHHDAPAQLREHLVDEVRRFETRAQQSGIAPEVIIGARYCLCTAVDEAAAL
TPWGGSIWSSQSLLVMFHNETWGGEKFFQLLSRLVQNPQQHLQLIELIYFCLAMGFEGRFRVIDNGRTQL
ETLKQRLLQIIRQTRGEIAVPLSPHWQDASAPVRRTRNWVPLWAVGAVAAVLLVLVFGVLTFSLAGRSDG
AFAAVNAVRLPQTQRAVAVAPAPQPRLQRFLEPEIRDGLLTVRDEADRSVVVLRGDGLFASGSDRVLDRY
APVLARVADALNSVEGNVLVSGFSDDQPIRSVRFPSNWQLSQARADAVKKMIATRVTRPERLRAEGRGDA
DPLVPNDSPANRARNRRVEVTLLVAPVAAGAAPAPQGGTR
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|239813019|ref|NC_012791.1|:223612-224994 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGAACGGTGTCAACGACATGGCCGTCGGTCCGGGAGGCTTCGTGCCGCCCAACCCGGGCGGCGGCGCCA
ACAACAACGGCGGCAACGGCGATGCGGCGGGCATGCCGCCGGCATCGCGCGGCGCGGGGCAGCAGCAACC
GCAGTCATTCACCGCCTGGCATGACGCACGCCGTCCGCATGCGGGCGACACGGCGCTGGCCGGCAACAAC
CCGCTCGTCGCGGCGGCCAACCCGCTGCTCGACCTGATCCCGCAGATCCGCGCCACCGGCCACCACGATG
CGCCCGCGCAATTGCGCGAGCACCTGGTCGACGAGGTCCGGCGCTTCGAGACGCGCGCGCAGCAAAGCGG
CATTGCGCCCGAAGTGATCATCGGCGCGCGCTACTGCCTGTGCACCGCGGTCGACGAAGCGGCCGCGCTC
ACGCCCTGGGGCGGCAGCATCTGGTCGTCGCAGAGCCTGCTCGTGATGTTCCACAACGAGACCTGGGGCG
GCGAGAAATTCTTCCAGCTGCTGTCGCGGCTGGTGCAGAACCCGCAGCAGCACCTGCAGCTGATCGAGCT
CATCTACTTCTGCCTGGCGATGGGCTTCGAAGGGCGCTTCCGCGTCATCGACAACGGCCGCACGCAGCTC
GAAACGCTCAAGCAGCGGCTGCTGCAGATCATTCGCCAGACGCGCGGCGAAATTGCCGTGCCGCTGTCGC
CGCACTGGCAGGATGCGAGCGCGCCGGTGCGCCGCACGCGCAACTGGGTGCCGCTGTGGGCCGTGGGCGC
GGTGGCGGCGGTGCTGCTGGTGCTGGTGTTCGGCGTGCTCACCTTCAGCCTGGCGGGCCGTTCCGACGGC
GCATTCGCCGCGGTCAATGCGGTGCGCCTGCCGCAGACGCAGCGTGCCGTGGCCGTTGCGCCGGCACCGC
AGCCGCGGCTGCAGCGCTTTCTCGAACCCGAGATCCGCGACGGCCTGCTGACGGTGCGCGACGAGGCCGA
CCGCAGCGTGGTGGTGCTGCGCGGCGACGGCCTGTTCGCATCGGGCTCCGACCGCGTGCTCGACCGCTAT
GCGCCCGTGCTCGCGCGCGTGGCCGATGCGCTCAACTCGGTGGAGGGCAACGTGCTCGTCAGCGGCTTCA
GCGACGACCAGCCGATCCGCAGCGTGCGCTTTCCGTCCAACTGGCAGCTCTCGCAGGCGCGTGCCGATGC
GGTCAAGAAGATGATCGCCACGCGCGTCACGCGGCCCGAGCGCCTGCGCGCCGAAGGCCGCGGCGATGCC
GATCCGCTGGTGCCTAATGATTCGCCGGCCAACCGTGCGCGCAACCGGCGGGTCGAAGTGACGCTGCTGG
TGGCACCCGTGGCCGCAGGCGCCGCTCCTGCACCGCAGGGAGGAACCCGCTGA
 Primer design