SecReT6
Protein ID: 239813232
SecReT6 ID347
T6SS typei3
Gene symbol-
Locus tagVapar_0213
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]224994..228629 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC5CX72
KEGG IDvap:Vapar_0213
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.10E-97, Aligned region: 207..471
ImcF-related_N [PF14331], Evalue: 1.10E-97, Aligned region: 836..866
IcmF-related [PF06761], Evalue: 3.10E-88, Aligned region: 526..836
IcmF-related [PF06761], Evalue: 3.10E-88, Aligned region: 908..954
DUF1215 [PF06744], Evalue: 1.80E-35, Aligned region: 945..1068
Protein Sequence: 1211 a.a.     [Download]
>gi|239813232|ref|YP_002942142.1| type VI secretion protein IcmF [Variovorax paradoxus S110]
MLRAIFRFLVSRDLWVFLGLLAVAFLIWIIGPVIAVGRYRPFESEFVRIVVIALMFAIWIARVLYRKWRE
RRLNAQLLNQLRTPSPKEKAAKPEDAPEIKELQSGFTDATSILKNMRFGADAGGKPAGRFALFDRQYLYQ
LPWYIFIGAPGSGKTTALVNSDLDFPLADQLGKAAVRGIGGTRNCDWWFTNEAVLIDTAGRYTTHESNRE
TDEGEWKGFLDLLKKFRPRQPINGAILTISIADLPLADDAQRARHAMALRKRLLELRNGLGINFPVYVLV
TKTDLLAGFNEYFGALGRAERSQVWGFTFPIDANPADPAKADLRERFHQEYKLLHQRLDERLPELLAAEP
DQLRRAQAYLLPQQFASFEDILGTFLADVFNPSKFEVAPMLRGVYFTSGTQEGTAFDRVMGAIKRYLQVN
APPAPPPGPGKSYFLKELLQQVIFRDAGVAGTNLRWYRRKRAIDLAGYGLIGVLLVVVLGACVNSWRNNR
DYVAEVDTNAKAFNKAAARGELPTVVDSNSDIASSLPVLDRLRDLPKSSHFDIGDPPMGYRFGLYQGEKL
QAATDGVYQRALEGVLLPQAAQRVEQALREASKTDAEYSYEALKAYLMLYDAERYDADFLQAWLLTDVDR
KIGAGLTREQRTNLESHLKALFAERVVTSPFAKDDRLVTETRNRLAGVPLAQRAYARLRRILLQTSPPNA
FSIAEAAGAESALVIKRTSGKPLTDGIPTLFTYRGYWDIFDKRMAETTLALEQEDRWVLQIRAPGMADIT
SRELLLREVRRLYLTDYIRVWDDYLLDVRLADSRSLLQSIQMTRVLSTSESPMSRLIRGAARETDLLRNH
DEATRSLLDQAQNRVASTRERIEQLIGQPDGSQRRNTVPDRPESLVDNHFAPLRRMVTAPKAGGQAPIDA
TAALINELYTFLTATDTALRSGNIPPSSDAVTKVQAEAGRLPVPFQGMLNDLSATASSKAAAVTRQNIGQ
NAAATIGQFCSQAIAGRYPFSRGSNRDVAAGDFAQLFAPGGMMDDFFQKNLASQVDTSVNPWAFKKGVDG
SSPGRSAYLDSFQKAQAIRDVFFSGMAGGRTPSFTIDIRPEDMDAAISQFTLDIDGQTVRYAHGPQAPST
VKWPGPRNSNQVRLQVTTASGTPAGGIVTEGPWALHRLFDKASISSGSAPESFNATFDLQGKKVVLAVTA
NSVYNPLRLHQMNGFSCPGKS
 
Nucleotide Sequence: 3636 bp     [Download]
>gi|239813019|ref|NC_012791.1|:224994-228629 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGCTGCGCGCGATTTTCCGTTTTCTCGTGAGCCGCGACCTGTGGGTCTTTCTCGGGCTGCTGGCCGTTG
CGTTCCTGATCTGGATCATCGGCCCCGTCATTGCGGTGGGCCGCTACCGGCCGTTCGAAAGCGAGTTCGT
GCGCATCGTGGTGATCGCGCTGATGTTCGCGATCTGGATCGCGCGCGTGCTCTACCGCAAGTGGCGCGAG
CGGCGCCTCAATGCGCAGCTGCTCAACCAGCTGCGCACGCCGTCGCCCAAGGAGAAGGCCGCCAAGCCCG
AGGATGCGCCCGAGATCAAGGAGCTGCAAAGCGGCTTCACCGACGCCACGTCCATCCTGAAGAACATGCG
TTTCGGCGCCGATGCCGGCGGCAAGCCCGCGGGGCGCTTCGCGCTGTTCGACCGCCAGTACCTGTACCAG
CTGCCCTGGTACATCTTCATCGGCGCGCCGGGCTCGGGCAAGACCACCGCGCTGGTCAACTCCGACCTCG
ACTTCCCACTGGCCGACCAGCTCGGCAAGGCCGCGGTGCGCGGCATCGGCGGCACGCGCAACTGCGACTG
GTGGTTCACCAACGAGGCGGTGCTGATCGACACCGCCGGGCGCTACACCACGCACGAGAGCAACCGCGAG
ACCGACGAGGGCGAGTGGAAGGGCTTCCTCGACCTGCTCAAGAAGTTCAGGCCGCGCCAGCCGATCAACG
GTGCCATCCTCACCATCAGCATTGCCGACCTGCCGCTGGCCGACGACGCGCAGCGCGCGCGCCACGCGAT
GGCGCTGCGCAAGCGGCTGCTCGAACTGCGCAACGGCCTGGGCATCAATTTTCCGGTGTACGTGCTGGTC
ACCAAGACCGACCTCTTGGCCGGCTTCAACGAGTACTTCGGCGCGCTCGGCCGCGCCGAGCGCTCGCAGG
TCTGGGGCTTCACCTTCCCGATCGATGCCAACCCCGCAGACCCGGCCAAGGCCGACCTGCGCGAGCGCTT
CCACCAGGAATACAAGCTGCTGCACCAGCGCCTGGACGAGCGCCTGCCGGAACTGCTGGCGGCCGAGCCC
GACCAGCTGCGCCGCGCGCAGGCCTACCTGCTGCCGCAGCAGTTCGCGAGCTTCGAGGACATCCTGGGCA
CCTTCCTGGCCGACGTGTTCAACCCCTCGAAGTTCGAAGTCGCGCCGATGCTGCGCGGCGTGTACTTCAC
CAGCGGCACGCAGGAGGGCACGGCTTTCGACCGCGTGATGGGCGCGATCAAGCGCTACCTGCAGGTCAAC
GCGCCGCCCGCGCCGCCGCCGGGCCCGGGCAAGAGCTACTTCCTCAAGGAGCTGCTGCAGCAGGTGATCT
TCCGCGACGCGGGCGTGGCCGGCACCAACCTGCGCTGGTACCGGCGCAAGCGCGCCATCGACCTCGCGGG
CTACGGCCTCATCGGCGTGCTGCTGGTGGTGGTGCTGGGCGCCTGCGTGAACAGCTGGCGCAACAACCGC
GACTACGTGGCCGAGGTCGACACCAACGCCAAGGCCTTCAACAAGGCCGCGGCGCGCGGCGAACTGCCGA
CGGTGGTCGATTCCAACAGCGACATCGCGAGCTCGCTGCCCGTGCTCGACCGCCTGCGCGACCTGCCCAA
GTCGAGCCATTTCGACATCGGCGATCCGCCCATGGGCTATCGCTTCGGCCTCTACCAGGGCGAGAAGCTG
CAGGCCGCGACCGACGGCGTCTACCAGCGCGCGCTCGAAGGCGTGCTGCTGCCGCAGGCCGCGCAGCGCG
TGGAGCAGGCGCTGCGCGAGGCCTCCAAGACCGATGCCGAATACAGCTACGAGGCGCTCAAGGCCTACCT
CATGCTGTACGACGCGGAGCGCTACGACGCCGACTTTCTCCAGGCCTGGCTGCTCACCGACGTGGACCGC
AAGATCGGCGCCGGCCTCACGCGCGAGCAGCGCACCAACCTCGAGTCGCACCTGAAGGCGCTGTTCGCCG
AACGCGTGGTGACCTCGCCCTTCGCCAAGGACGACCGGCTCGTCACCGAGACGCGCAACCGCCTGGCCGG
CGTGCCGCTGGCGCAGCGCGCCTATGCGCGGCTGCGGCGCATCCTGCTGCAGACCAGTCCGCCCAATGCC
TTCAGCATCGCGGAGGCGGCGGGGGCCGAGTCGGCGCTGGTGATCAAGCGCACGAGCGGCAAGCCGCTCA
CCGACGGCATCCCGACGCTGTTCACCTACCGCGGCTACTGGGACATCTTCGACAAGCGCATGGCCGAGAC
CACGCTTGCGCTCGAACAGGAAGACCGCTGGGTGCTGCAGATCCGCGCGCCCGGCATGGCCGACATCACC
TCGCGCGAGCTGCTGCTGCGCGAGGTGCGCCGGCTCTACCTCACCGACTACATCCGCGTCTGGGACGACT
ACCTGCTCGACGTCCGGCTGGCCGACAGCCGCTCGCTGCTGCAGAGCATCCAGATGACGCGCGTGCTCTC
GACCAGCGAGTCGCCGATGTCGCGCCTCATCCGCGGCGCGGCGCGCGAGACCGACCTGCTGCGCAACCAC
GACGAAGCCACGCGCAGCCTGCTCGACCAGGCGCAGAACCGCGTGGCCAGCACGCGCGAGCGCATCGAGC
AGCTCATCGGGCAGCCCGACGGCAGCCAGCGCCGCAACACCGTGCCGGACCGCCCCGAATCGCTGGTGGA
CAACCACTTCGCGCCGCTTCGCCGCATGGTCACCGCGCCCAAGGCCGGCGGCCAGGCGCCGATCGACGCG
ACGGCCGCGCTCATCAACGAGCTCTACACCTTCCTCACCGCCACCGACACGGCATTGCGCAGCGGCAACA
TCCCGCCATCGAGCGACGCGGTCACCAAGGTGCAGGCCGAGGCGGGCCGCCTGCCGGTGCCGTTCCAGGG
CATGCTGAACGACCTCTCGGCCACCGCGTCGTCCAAGGCGGCGGCGGTGACGCGGCAGAACATCGGGCAG
AACGCGGCCGCCACCATCGGCCAGTTCTGCAGCCAGGCCATTGCGGGGCGCTATCCGTTCTCGCGCGGCT
CGAACCGCGACGTGGCCGCCGGCGACTTCGCGCAGCTGTTCGCGCCGGGCGGCATGATGGACGACTTCTT
CCAGAAGAACCTGGCCTCGCAGGTCGACACCTCCGTCAACCCCTGGGCCTTCAAGAAGGGCGTGGACGGC
AGCTCGCCGGGGCGCTCGGCGTACCTCGATTCGTTCCAGAAGGCGCAGGCGATCCGCGACGTGTTCTTCT
CGGGCATGGCGGGCGGGCGCACGCCCTCGTTCACCATCGACATCCGGCCCGAGGACATGGACGCCGCCAT
CAGCCAGTTCACGCTCGACATCGACGGCCAGACGGTGCGCTATGCGCACGGACCGCAGGCGCCCAGCACC
GTCAAGTGGCCCGGCCCGCGCAACAGCAACCAGGTGCGGCTGCAGGTGACGACCGCCAGCGGCACGCCGG
CCGGCGGCATCGTCACCGAAGGGCCGTGGGCGCTGCACCGGCTGTTCGACAAGGCCTCCATTTCGTCGGG
CAGCGCGCCCGAATCGTTCAACGCGACCTTCGACCTGCAAGGCAAGAAGGTGGTGCTCGCGGTGACGGCG
AACAGCGTCTACAACCCGCTGCGCCTGCACCAGATGAACGGCTTTTCGTGCCCCGGGAAATCCTGA
 Primer design