SecReT6
Protein ID: 239813533
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0514
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]563214..564545 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDC5CK79
KEGG IDvap:Vapar_0514
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.90E-150, Aligned region: 19..442
Protein Sequence: 443 a.a.     [Download]
>gi|239813533|ref|YP_002942443.1| type VI secretion protein [Variovorax paradoxus S110]
MSWRTKVVWSEGMLLQPQHLQQSERHADHARHVLLRSTTPYAWGFAEIEIDQAALTLGKLALVRAVGLFG
DGTVFDMPAVDPLPEPIDIPPAMRDEAVVLALPLRRAGAREADAEDYEELVRHRVLESEVPDSNTAGERT
AVLQLGQLHTRLMRASEATDAWTTLGVARVLERRVDNQVQLDRAMLPPLLDVAGHAVIRSWLDELLGLLR
QRGEALAGRMTQGGTGGVAEIADFMLLQTVNRNEAVFAHLAQSAMLHPQHFFEHALGLAGDLASFRDSRR
VTRFGPYVHDDLALSFRPLMDDLRRSLSMVLEQSAIRIDLHDRKHGVRVAVVTDVELQRKATFVLAVNAN
MPSEALRARFPTQVKIGPVERIRDLVNLALPGVTLTPMPVAPRQIPFHTGANYFELETRNSDLWRQLEQS
GGIAMHIAGDFPGLDLAFWAIRS
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|239813019|ref|NC_012791.1|:563214-564545 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGAGTTGGCGAACAAAAGTGGTCTGGAGCGAGGGGATGCTGCTGCAGCCCCAGCACCTGCAGCAAAGCG
AGCGTCATGCCGACCATGCGAGGCATGTGCTGCTGCGTTCCACCACGCCCTATGCCTGGGGATTCGCGGA
GATCGAGATCGATCAGGCCGCGCTCACGCTGGGCAAGCTCGCGCTGGTGCGGGCGGTGGGCCTGTTCGGC
GACGGCACGGTGTTCGACATGCCGGCGGTCGATCCGCTGCCCGAGCCCATCGACATTCCGCCCGCCATGC
GCGACGAGGCCGTGGTGCTGGCGCTGCCGCTGCGCCGCGCCGGTGCCCGCGAGGCCGATGCCGAAGACTA
TGAAGAGCTGGTGCGCCACCGCGTGCTCGAGTCCGAGGTGCCCGACTCCAACACCGCGGGCGAGCGCACC
GCCGTGCTGCAGCTGGGCCAGCTGCACACGCGCCTGATGCGCGCCAGCGAAGCCACCGATGCCTGGACCA
CGCTGGGCGTGGCGCGCGTGCTGGAGCGCCGCGTCGACAACCAGGTGCAGCTCGACCGCGCGATGCTGCC
GCCGCTCTTGGACGTGGCGGGCCATGCCGTGATCCGTTCCTGGCTCGACGAGCTGCTGGGCCTCTTGCGC
CAGCGCGGCGAGGCGCTGGCCGGCCGCATGACGCAAGGCGGCACCGGCGGCGTGGCCGAGATCGCCGACT
TCATGCTGCTGCAGACCGTCAACCGCAACGAGGCGGTCTTCGCGCACCTGGCCCAAAGCGCCATGCTGCA
TCCGCAGCACTTCTTCGAGCATGCGCTCGGGCTGGCCGGCGACCTGGCGAGCTTTCGCGATTCGCGCCGC
GTCACGCGCTTCGGCCCCTACGTCCACGACGACCTGGCGCTGAGCTTCCGTCCGCTGATGGACGACCTGC
GGCGCAGCCTCTCGATGGTGCTGGAGCAGTCGGCCATCCGCATCGACCTGCACGACCGCAAGCACGGCGT
GCGCGTGGCGGTGGTGACCGACGTGGAGCTGCAGCGCAAGGCGACCTTCGTGCTCGCGGTGAATGCCAAC
ATGCCGAGCGAAGCGCTGCGCGCGCGCTTTCCCACGCAGGTCAAGATCGGCCCGGTCGAGCGCATCCGCG
ACCTCGTGAACCTGGCGCTGCCGGGCGTCACGCTCACGCCGATGCCCGTGGCGCCAAGGCAGATTCCCTT
CCACACCGGCGCCAACTACTTCGAGCTCGAAACGCGCAACAGCGACCTGTGGCGCCAGCTGGAGCAATCG
GGCGGCATCGCGATGCACATCGCGGGCGACTTCCCCGGCCTCGACCTCGCGTTCTGGGCCATTCGTTCCT
AG
 Primer design