SecReT6
Protein ID: 239813534
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0515
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]564578..565906 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDC5CK80
KEGG IDvap:Vapar_0515
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-68, Aligned region: 55..260
OmpA [PF00691], Evalue: 1.10E-14, Aligned region: 324..421
Protein Sequence: 442 a.a.     [Download]
>gi|239813534|ref|YP_002942444.1| DotU family type IV/VI secretion system protein [Variovorax paradoxus S110]
MTTPDPFAAFESERTVIKPKPRTPAGTPPAPAPAPFFGGADPTPAVDVGEIGLLNPLVSAAGKLLVLIGK
LRNLVQPPNVPALRASTADAVNQFDAAARRAGASNESVLAARYVLCTALDEAVANTPWGVQAGWNKQSLL
VQFHNETWGGEKVFQLLAKLAQDVPTHRQLLELIYSVLALGFEGRYRVVDNGRAQLDSVRQRLADLIAKD
RPPLEAELSPHWRGQGAGTVRLRESLPLWVFAAGFALLLALAWFGLRLTLNYRSDTTYAAVSGLRVPNLQ
IAPPAAPAKSPRLARFLEPEIKQGLVTVTDEADRSVVRLRGDSFFGSGSAEPMAASLPVLRRIGQALAEV
KGEVLITGHSDNQPIRSLRYPSNWHLSAARADAVKGALTTLVEPARMRSDGKADAEPVAANDTPANRARN
RRVDIVLLSEPDRVAAAAGVTK
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|239813019|ref|NC_012791.1|:564578-565906 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGACAACACCCGATCCCTTCGCCGCCTTCGAGTCGGAGCGCACGGTCATCAAGCCCAAGCCGCGCACGC
CGGCCGGCACGCCGCCCGCGCCGGCTCCCGCACCGTTCTTCGGCGGCGCTGATCCGACGCCGGCCGTCGA
CGTCGGCGAGATCGGCCTGCTCAATCCGCTGGTCTCGGCCGCGGGCAAGCTGCTGGTGCTGATCGGAAAG
CTGCGCAACCTGGTGCAGCCGCCCAACGTGCCGGCCCTGCGCGCCTCCACCGCCGACGCGGTGAACCAGT
TCGATGCCGCCGCGCGCCGCGCCGGCGCCAGCAACGAATCGGTGCTGGCCGCACGCTACGTGCTGTGCAC
CGCGCTGGATGAAGCCGTGGCCAACACGCCCTGGGGCGTGCAGGCCGGCTGGAACAAGCAGAGCCTCTTG
GTGCAGTTCCACAACGAGACCTGGGGCGGCGAGAAGGTGTTCCAGCTGCTCGCCAAGCTCGCGCAGGACG
TGCCCACGCACCGCCAGCTGCTGGAGCTGATCTACAGCGTGCTCGCGCTCGGCTTCGAAGGCCGCTACCG
CGTGGTCGACAACGGCCGCGCGCAGCTCGATTCGGTGCGCCAGCGCCTGGCCGACCTGATCGCCAAGGAT
CGCCCGCCGCTCGAAGCCGAGCTTTCGCCGCACTGGCGCGGGCAGGGCGCGGGCACGGTGCGGCTGCGCG
AATCGCTGCCGCTGTGGGTGTTCGCGGCCGGCTTCGCGCTGCTGCTCGCGCTGGCCTGGTTTGGCCTGCG
GCTCACGCTCAACTACCGCTCCGACACCACCTATGCCGCGGTGTCGGGCCTGCGCGTGCCCAACCTCCAG
ATCGCGCCGCCTGCCGCGCCGGCCAAGTCGCCGCGGCTCGCGCGCTTTCTCGAGCCCGAGATCAAGCAGG
GCCTGGTCACCGTGACCGACGAGGCCGACCGCAGCGTGGTGCGGCTGCGCGGCGATTCCTTCTTCGGCTC
CGGCAGCGCCGAGCCCATGGCGGCCTCGCTGCCGGTGCTGCGCCGCATCGGCCAGGCGCTGGCCGAGGTG
AAGGGCGAGGTGCTGATCACCGGCCACTCCGACAACCAGCCGATCCGCTCGCTGCGCTATCCCTCCAACT
GGCACCTGTCGGCGGCGCGCGCCGATGCGGTGAAAGGCGCACTCACCACGCTGGTCGAGCCGGCGCGCAT
GCGCTCCGACGGCAAGGCCGACGCCGAGCCCGTGGCCGCCAACGACACGCCGGCCAACCGCGCGCGCAAC
CGGCGGGTGGACATCGTGCTCTTGTCCGAGCCGGACCGCGTGGCTGCCGCGGCGGGAGTGACGAAATGA
 Primer design