SecReT6
Protein ID: 239813535
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0516
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]565903..569502 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC5CK81
KEGG IDvap:Vapar_0516
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 206..472
ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 513..585
IcmF-related [PF06761], Evalue: 3.80E-89, Aligned region: 520..832
DUF1215 [PF06744], Evalue: 6.30E-32, Aligned region: 937..1058
Protein Sequence: 1199 a.a.     [Download]
>gi|239813535|ref|YP_002942445.1| type VI secretion protein IcmF [Variovorax paradoxus S110]
MIKKIFGFLFSPLLLTLLALVIVALLIWWIGPLVKIGAWVPLESELARALLIGAIVLVVVLRAIYRRWRA
RRASQHLTDGLMKAPAAKADAPVNGEQKILDTRFSEAVATLKQMRLHAAGKKPGWRDWLSISGGSYLYDL
PWYVFIGAPGAGKTTALVNSGLSFPLAEKFGPGAIRGVGGTRNCDWWFTDEAVLIDTAGRYTTQDSHQSE
DKSAWEGFLGLLKKARPRRPLNGVFLTVSVADLLSQGPEQRTQLAASIRARLLELDAKLTTRLPVYVLVT
KSDLLYGFTDYFDDLGKEQRAQVFGFTLAADENVQADEKGLSTAFHREFALLHNRVNDGLIARMQRETDG
TRRAAIFGFPAQFGSIGSMLSDLLDQVFTGSRFAQPPWVRGVYFTSGTQEGSPIDRVMGSLARSFGIERA
MLAPQKSSGRSYFLTALLREVVFPEQRLAGANVKLERRRHALRMAGVAAMTLVTLALLAGWGYSTLQNLN
YLKSVEARVEPARQTLAALPSRVQNLVEVAPVLQGLRDIWKTPDNRQGDEPLSMTLGLYQGDKLDAAAML
THQRALNDAFLPQIAKRIEDQLRTAQKDNLEYTYEALKSYLMLYQPEHFDAEALKAWITLDWARSLDRGI
PEDQRQALEDQLDVLIAQGPPRSPLKMDENLVRSVRAVLASYPLEQRVFSRLKRQRATKDIPAFSIATAA
GPSAPLVFERISGKPLTEGVPGMFTYDGYHKRFQNEVTVLTGLLAQEDPWVLGQDRSAADRMRDVAALGA
LTDRVRRLYLAEYVKVWEALLADVRLIRASGLEKNIEAARILSGVGSPLANFLRAVVKETTLIPADQPKD
VVSKATATVASTRKGLEDLFGGDPNKAVASGKRIESIVDDRFEPLRRLVTAAGPNQPAPIDDALKLFNEV
YVYLTAVDTAVKGRTSPPPGDVAGKLKSDAGRLPEPVRTMVENLSQSGAAQAQVAERGNLSQDLRPVTDF
CNRAIAGRYPFVGSSKRDVLPEDFGQMFGAGGLMDEFFQKRLAALVDTSTKPWRYKPVAERGAVTTQALA
QFERAARIKDIFFRGGGRGPSMRLDFKPVEMDAGITQFILDVDGQLVKYAHGPVVPMAVQWPGPKGSYQV
RIQVSPPSATGSSGAAVDGPWALFRALDDGQLEAGDAPEKFFITFQIGARKTRFEVTTNSVQHPIRLKEL
REFSCPEGL
 
Nucleotide Sequence: 3600 bp     [Download]
>gi|239813019|ref|NC_012791.1|:565903-569502 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGATCAAGAAAATCTTCGGCTTCCTGTTCAGCCCGCTGCTGCTGACGCTGCTGGCGCTGGTCATCGTCG
CGCTCCTGATCTGGTGGATCGGCCCGCTGGTGAAGATCGGCGCGTGGGTGCCGCTCGAAAGCGAGCTCGC
ACGCGCGCTGCTGATCGGGGCCATCGTGCTCGTCGTGGTGCTGCGCGCGATCTACCGCCGCTGGCGCGCG
CGCCGTGCGAGCCAGCACCTGACCGACGGCCTCATGAAGGCGCCCGCCGCCAAGGCCGATGCGCCGGTCA
ACGGCGAGCAGAAGATCCTGGACACGCGCTTCAGCGAAGCCGTGGCCACGCTCAAGCAGATGCGTCTGCA
TGCCGCGGGCAAGAAGCCCGGCTGGCGCGACTGGCTCTCCATTTCCGGCGGCAGCTACCTGTACGACCTG
CCTTGGTACGTGTTCATCGGCGCGCCTGGCGCGGGCAAGACCACGGCGCTGGTCAACTCGGGCCTCTCGT
TCCCGCTGGCCGAGAAGTTCGGCCCCGGCGCGATCCGCGGCGTGGGTGGCACGCGCAACTGCGACTGGTG
GTTCACCGACGAGGCCGTGCTCATCGACACCGCCGGCCGCTACACCACGCAGGACAGCCACCAGTCGGAA
GACAAGAGCGCGTGGGAGGGCTTCCTCGGCCTGCTCAAGAAGGCGCGTCCGCGCCGGCCGCTCAACGGCG
TGTTCCTCACGGTGAGCGTGGCCGACCTGCTGAGCCAGGGCCCGGAGCAGCGCACGCAGCTGGCCGCGTC
CATCCGCGCGCGGCTGCTCGAGCTCGATGCGAAGCTCACCACGCGGCTGCCGGTGTATGTGCTGGTCACC
AAGAGCGACCTGCTCTATGGCTTCACCGACTACTTCGACGACCTCGGCAAGGAGCAGCGCGCGCAGGTCT
TCGGCTTCACGCTGGCGGCCGACGAGAACGTGCAGGCCGACGAGAAGGGCCTGTCCACCGCCTTCCACCG
CGAGTTTGCGCTGCTGCACAACCGCGTCAACGACGGGCTCATCGCACGCATGCAGCGCGAGACCGACGGC
ACGCGGCGCGCGGCGATCTTCGGCTTTCCGGCGCAGTTCGGCTCCATCGGCTCGATGCTGTCGGACCTGC
TCGACCAGGTGTTCACCGGCTCGCGCTTCGCGCAGCCGCCGTGGGTGCGCGGCGTGTACTTCACCAGCGG
CACGCAGGAAGGCAGCCCGATCGACCGCGTGATGGGCAGCCTCGCGCGCAGCTTCGGCATCGAGCGCGCG
ATGCTCGCGCCGCAGAAGTCCAGCGGCCGCAGCTACTTTCTCACTGCGCTGCTGCGCGAGGTGGTGTTCC
CCGAGCAGCGCCTGGCCGGCGCCAACGTGAAGCTGGAGCGCCGTCGCCATGCGCTGCGCATGGCGGGCGT
GGCGGCCATGACGCTGGTCACGCTCGCGCTGCTCGCGGGCTGGGGCTACAGCACGCTGCAGAACCTCAAC
TACCTGAAGTCGGTCGAGGCGCGCGTCGAGCCCGCGCGCCAGACCCTCGCGGCCCTGCCTTCGCGGGTGC
AGAACCTGGTCGAGGTGGCGCCGGTGCTGCAGGGCCTGCGCGACATCTGGAAGACACCCGACAACCGCCA
GGGCGACGAGCCGCTGTCGATGACGCTCGGCCTCTACCAGGGCGACAAGCTCGACGCCGCCGCCATGCTC
ACGCACCAGCGTGCGCTCAACGACGCCTTCCTGCCGCAGATCGCCAAGCGCATCGAGGACCAGCTGCGCA
CCGCGCAGAAGGACAACCTCGAATACACCTACGAGGCGCTCAAGAGCTACCTCATGCTCTACCAGCCCGA
GCATTTCGATGCCGAGGCGCTCAAGGCCTGGATCACGCTCGACTGGGCGCGCAGCCTGGACCGCGGCATT
CCCGAAGACCAGCGCCAGGCGCTCGAAGACCAGCTCGACGTGCTCATTGCCCAGGGCCCGCCACGCTCGC
CGCTCAAGATGGACGAGAACCTGGTGCGCAGCGTGCGTGCCGTGCTCGCGAGCTATCCGCTGGAGCAGCG
CGTGTTCAGCCGCCTGAAGCGCCAGCGCGCCACCAAGGACATTCCGGCCTTCAGCATTGCCACCGCCGCC
GGCCCCTCGGCGCCGCTGGTGTTCGAGCGCATCAGCGGCAAGCCGCTGACCGAAGGCGTGCCGGGCATGT
TCACCTACGACGGTTATCACAAGCGCTTCCAGAATGAAGTGACGGTGCTCACCGGCCTGCTCGCGCAGGA
AGACCCGTGGGTGCTCGGGCAGGACCGCAGCGCTGCCGACCGCATGCGCGACGTGGCCGCGCTCGGCGCG
CTGACCGACCGCGTGCGCCGCCTCTATCTTGCGGAGTACGTCAAGGTCTGGGAGGCGCTCCTGGCCGACG
TGCGGCTGATCCGCGCCAGCGGGCTCGAGAAGAACATCGAGGCCGCGCGCATTCTCTCGGGCGTGGGCTC
GCCGCTTGCGAACTTCTTGCGCGCGGTGGTGAAGGAGACCACGCTCATTCCGGCCGACCAGCCCAAGGAC
GTGGTGAGCAAGGCCACCGCCACCGTCGCGAGCACCCGCAAGGGCCTGGAAGACCTGTTCGGCGGCGACC
CCAACAAGGCCGTGGCCAGCGGCAAGCGCATCGAGAGCATCGTGGACGACCGCTTCGAGCCGCTGCGCCG
CCTGGTCACCGCGGCCGGACCGAACCAGCCCGCGCCAATCGACGATGCGCTCAAGCTCTTCAACGAGGTG
TATGTGTACCTCACGGCCGTCGACACCGCCGTGAAGGGGCGCACCTCGCCGCCGCCCGGCGACGTGGCCG
GCAAGCTCAAGTCCGACGCGGGCCGCCTGCCCGAGCCAGTGCGCACCATGGTGGAGAACCTGAGCCAGTC
GGGCGCGGCGCAGGCCCAGGTGGCCGAGCGCGGCAACCTGAGCCAGGACCTGCGTCCCGTGACCGACTTC
TGCAACCGCGCCATCGCGGGCCGCTACCCCTTCGTGGGCAGCAGCAAGCGCGACGTGCTGCCCGAGGACT
TCGGCCAGATGTTCGGCGCCGGCGGCCTGATGGACGAGTTCTTCCAGAAGCGGCTGGCCGCGCTGGTCGA
CACCAGCACCAAGCCCTGGCGCTACAAGCCCGTGGCCGAACGCGGCGCCGTCACCACGCAGGCGCTGGCG
CAGTTCGAGCGGGCCGCGCGCATCAAGGACATCTTCTTCCGCGGCGGCGGCCGAGGCCCGTCGATGCGGC
TGGACTTCAAGCCGGTGGAGATGGATGCGGGCATCACGCAATTCATCCTCGACGTCGACGGCCAGCTCGT
GAAGTACGCGCACGGCCCGGTGGTCCCCATGGCCGTGCAGTGGCCCGGCCCGAAGGGCAGCTACCAGGTG
CGCATCCAGGTGAGCCCGCCTTCGGCCACCGGCAGTTCGGGCGCCGCGGTCGATGGGCCATGGGCGCTGT
TCCGCGCGCTCGACGACGGCCAGCTCGAAGCGGGCGATGCGCCCGAGAAGTTCTTCATCACCTTCCAGAT
CGGCGCGCGCAAGACGCGCTTCGAAGTGACGACGAACAGCGTGCAGCATCCGATCCGCTTGAAGGAGCTG
CGCGAGTTCTCCTGTCCGGAGGGGCTGTGA
 Primer design

Protein ID: 239813572
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0553
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]612383..613513 [-]
Producthypothetical protein
NoteTssM
UniProt IDC5CKB8
KEGG IDvap:Vapar_0553
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.50E-32, Aligned region: 153..339
ImcF-related_N [PF14331], Evalue: 6.50E-32, Aligned region: 340..367
Protein Sequence: 376 a.a.     [Download]
>gi|239813572|ref|YP_002942482.1| hypothetical protein Vapar_0553 [Variovorax paradoxus S110]
MPAALLPAHFFWLLLALCLAGFALLYAAVHDAGRGARRRALRRRIAALGPPAAEADEAAIESMREAMRKA
MSHARQLLRQPSCQQAAPVPWFLFLGDAAANLPGLLAAAHAEHLAPSGSEPFGEPYWRWWLTGSMTAIEL
HPSAVSDVAAAPHTRALWLQALLALAERRDRVPINGVVACVAASELLHPSSAGMKPLAGRMRRLLDEAAD
TLRLQLPVYLVVTGLEQLAGYATLRGALPPEVLAQVIGHRLAGPAAHGETAAERLDALFDPMARQLHALR
MALLREQPGASGRLAIHEFIEALRALQPALREVAEALFESHGRGSRGPRWRGLYVTAAASGAAGGAFVTD
LFERFLPADQPLARPGRAPNASAAKA
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|239813019|ref|NC_012791.1|:c613513-612383 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGCCCGCCGCGTTGTTGCCTGCCCATTTCTTCTGGCTCCTGCTCGCGCTGTGCCTGGCCGGCTTTGCGC
TGCTGTACGCCGCGGTCCACGACGCGGGCCGCGGTGCGCGCCGCCGCGCGCTGCGCCGGCGCATTGCCGC
ACTCGGCCCGCCGGCGGCCGAAGCCGACGAAGCCGCGATCGAATCCATGAGGGAGGCCATGAGGAAAGCC
ATGTCGCACGCACGCCAGCTCCTGCGCCAGCCATCGTGCCAGCAAGCCGCACCGGTGCCCTGGTTCCTCT
TTCTCGGCGATGCGGCGGCCAACCTGCCGGGGCTGCTGGCGGCGGCCCATGCCGAGCACCTGGCACCTTC
GGGCAGCGAGCCTTTCGGCGAACCCTACTGGCGCTGGTGGCTCACCGGCTCGATGACGGCCATCGAGCTG
CACCCGAGCGCCGTCAGCGACGTGGCCGCGGCGCCGCACACGCGTGCGCTGTGGCTCCAGGCGCTCCTCG
CACTGGCCGAGCGGCGCGACCGCGTGCCGATCAACGGCGTGGTGGCCTGCGTGGCGGCGAGCGAACTGCT
GCACCCGTCCAGCGCAGGCATGAAGCCGCTGGCCGGCAGGATGCGCCGGCTGCTCGACGAGGCCGCGGAC
ACCCTGCGCCTGCAGCTGCCGGTCTACCTGGTCGTGACCGGCCTGGAGCAGCTGGCCGGCTATGCCACGC
TGCGCGGTGCGCTGCCGCCCGAAGTGCTCGCACAGGTGATCGGCCATCGCCTGGCCGGGCCGGCCGCCCA
CGGCGAGACCGCGGCCGAACGGCTCGATGCCCTGTTCGACCCCATGGCGCGCCAGCTGCATGCGCTGCGC
ATGGCGCTGCTGCGCGAACAGCCGGGCGCATCGGGCCGGCTCGCGATCCATGAGTTCATCGAGGCGCTGC
GGGCGCTGCAGCCCGCATTGCGCGAAGTGGCCGAGGCCCTGTTCGAAAGCCATGGCCGCGGCTCGCGCGG
CCCGCGATGGCGCGGCCTCTATGTGACGGCTGCCGCATCGGGTGCGGCCGGCGGCGCCTTCGTGACCGAC
CTGTTCGAGCGCTTCCTGCCCGCCGACCAGCCGCTCGCGCGGCCCGGCCGCGCGCCGAACGCCAGCGCGG
CGAAGGCGTGA
 Primer design