SecReT6
Protein ID: 239813544
SecReT6 ID348
T6SS typei3
Gene symbol-
Locus tagVapar_0525
StrainVariovorax paradoxus S110
Repliconchromosome I [GenBank: NC_012791] [Browse all T6SS(s) in this replicon]
Location [Strand]579066..579902 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDC5CK90
KEGG IDvap:Vapar_0525
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.10E-43, Aligned region: 139..260
Protein Sequence: 278 a.a.     [Download]
>gi|239813544|ref|YP_002942454.1| virulence protein SciE type [Variovorax paradoxus S110]
MASSAELLKSADPVAALKALSDEVRAKPADSKHRVFMAQLLCVLGQWERALNQLTVAAELDALAVPMKQV
YGDAVRCEGLRAEVFAGTRTPMIFGQPDEWLALLIESLLRQGRGESELAEDLRQRAFDGAPAIAGTIDGV
PFEWLADADMRLGPVLEAFVNGKYYWIPYARLAHIKIEPPEDLRDCVWMPAHLQFENGGETLALIPTRYE
GTEQSEDGELRLARKTEWRELRPEVWAGRGQRVLGSDAGEYALMDVREILFTPTASAAAQDGPGDAGG
 
Nucleotide Sequence: 837 bp     [Download]
>gi|239813019|ref|NC_012791.1|:579066-579902 Variovorax paradoxus S110 chromosome 1, complete sequence
ATGGCCAGCTCCGCCGAACTCCTCAAGTCCGCCGACCCCGTCGCCGCGCTCAAGGCCCTGAGCGACGAGG
TCCGCGCCAAGCCCGCCGACAGCAAGCACCGCGTCTTCATGGCGCAGCTGCTGTGCGTGCTGGGCCAGTG
GGAACGCGCGCTCAACCAGCTCACTGTCGCAGCCGAGCTCGATGCGCTCGCCGTTCCCATGAAGCAGGTG
TATGGCGACGCCGTGCGCTGCGAAGGCCTGCGCGCCGAGGTGTTCGCCGGCACGCGCACGCCGATGATCT
TCGGCCAGCCCGACGAATGGCTGGCGCTGCTGATCGAATCGCTGCTGCGCCAGGGCCGCGGCGAGAGCGA
GCTGGCCGAAGACCTTCGCCAGCGGGCCTTCGACGGCGCACCCGCCATCGCCGGCACCATCGACGGCGTG
CCCTTCGAATGGCTGGCCGATGCCGACATGCGCCTGGGCCCGGTGCTCGAAGCCTTCGTCAACGGCAAGT
ACTACTGGATTCCCTACGCCCGGCTCGCGCACATCAAGATCGAGCCGCCCGAAGACCTGCGCGACTGCGT
CTGGATGCCCGCCCACCTGCAGTTCGAGAACGGCGGCGAGACGCTGGCGCTCATTCCCACCCGCTACGAA
GGCACCGAGCAGAGCGAGGATGGCGAGCTGCGGCTCGCGCGCAAGACCGAGTGGCGCGAACTGCGCCCCG
AGGTCTGGGCCGGCCGCGGCCAGCGCGTGCTCGGCAGCGACGCCGGCGAGTACGCGCTCATGGACGTGCG
CGAGATCCTTTTCACGCCCACTGCCTCTGCCGCAGCGCAGGACGGCCCCGGCGACGCAGGCGGCTGA
 Primer design